From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00037
  • pan locus tag?: SAUPAN000838000
  • symbol: SAOUHSC_00037
  • pan gene symbol?: sqr
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00037
  • symbol: SAOUHSC_00037
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 40821..42014
  • length: 1194
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGAATAAGCATTATCAAATTGTTATTATTGGTGGCGGTACAGCAGGTGTTACCGTAGCA
    TCAAGACTATTAAGAAAAAATCAAAACTTAAAAGAGAAAATAGCAATTATAGATCCAGCA
    GACCATCATTACTATCAACCATTATGGACGTTGGTTGGTGCAGGGGTATCTAGTTTGAAA
    AGTTCTCGTAAAGATATGGAAAGTGTTATACCTGAAGGTGCTAACTGGATAAAACAGGCT
    GTTTCAAGTTTTCAACCTGAAAATAATAGCGTTATTTTAGGAGATAATACAGTCGTTTAT
    TATGATTTTTTAGTAGTAGCTCCAGGATTACAGATTAATTGGTCTTCAATTAAAGGACTA
    AAAGAAAATATAGGTAAAAATGGTGTTTGCTCTAACTATTCACCTGACTATGTTAACGAA
    ACTTGGAACCAAATTTCTAATTTTAAACAAGGAAATGCCATTTTTACGCATCCAAACACT
    CCTATAAAGTGTGGAGGTGCGCCTATGAAAATTATGTATTTAGCTGAAGATTATTTTAGG
    AAACATAAAATCCGTTCTAACGCTAATGTGATATATGCAACGCCAAAAGATGCTTTATTT
    GACGTAGGAAAATATAATAAAGAATTAGAAAGGATTGTTGAAGAAAGAAATATAACAGTC
    AATTATAATTATAACCTTGTTGAAATCGACGGTGACAAAAAAGTGGCTACATTCGAACAT
    ATCAAAGCATACGATAGAAAAACAATAAGTTATGATATGTTACATGTAACACCACCTATG
    GGTCCCTTAGATGTAGTAAAAGAAAGTACACTTTCAGATAGTGAGGGTTGGGTAGATGTT
    AACCCAACCACATTACAGCATAAAAGCTACTCTAATGTATTTGCACTTGGTGATGCTTCA
    AATGTACCTACTTCAAAAACAGGCGCAGCTATTCGTAAGCAAGCACCTATCGTCGCTAAT
    AATTTATTGCAAGTGATGAATAATCAAATGTTAACGCATCATTATGATGGTTATACTTCA
    TGCCCTATTGTTACTGGATATAATAGGTTAATACTTGCAGAGTTTGATTATAATAAAAAT
    ACTAAAGAAACAATGCCGTTTAATCAGGCCAAAGAACGTAGAAGTATGTATATATTTAAG
    AAAGATTTATTACCTAAAATGTATTGGTACGGCATGCTAAAAGGATTAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1194

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00037
  • symbol: SAOUHSC_00037
  • description: hypothetical protein
  • length: 397
  • theoretical pI: 9.23837
  • theoretical MW: 44839.9
  • GRAVY: -0.393199

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    pyridine nucleotide-disulfide oxidoreductase family protein (TIGR03169; HMM-score: 60.8)
    Cellular processesCellular processesDetoxificationCoA-disulfide reductase (TIGR03385; EC 1.8.1.14; HMM-score: 35.4)
    MetabolismEnergy metabolismElectron transportthioredoxin-disulfide reductase (TIGR01292; EC 1.8.1.9; HMM-score: 25.2)
    oxidoreductase/SelD-related fusion protein (TIGR04369; HMM-score: 18.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinoneubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family (TIGR01988; EC 1.14.13.-; HMM-score: 15.3)
    ubiquinone biosynthesis monooxygenase COQ6 (TIGR01989; EC 1.14.13.-; HMM-score: 13.7)
    lycopene cyclase family protein (TIGR01790; HMM-score: 13.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone2-polyprenyl-6-methoxyphenol 4-hydroxylase (TIGR01984; EC 1.14.13.-; HMM-score: 12.6)
    dihydrolipoyl dehydrogenase (TIGR01350; EC 1.8.1.4; HMM-score: 12.3)
    Cellular processesCellular processesDetoxificationmercury(II) reductase (TIGR02053; EC 1.16.1.1; HMM-score: 12.3)
    Unknown functionEnzymes of unknown specificityflavoprotein, HI0933 family (TIGR00275; HMM-score: 11.9)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain (TIGR03197; HMM-score: 11.3)
    squalene-associated FAD-dependent desaturase (TIGR03467; HMM-score: 10.7)
    putative alkyl hydroperoxide reductase F subunit (TIGR03143; EC 1.6.4.-; HMM-score: 10.3)
  • TheSEED:  
    Sulfide:quinone oxidoreductase, Type II 
  • PFAM:
    NADP_Rossmann (CL0063) Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 60)
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 25.9)
    NAD_binding_9; FAD-NAD(P)-binding (PF13454; HMM-score: 22.4)
    DAO; FAD dependent oxidoreductase (PF01266; HMM-score: 19.2)
    Lycopene_cycl; Lycopene cyclase protein (PF05834; HMM-score: 18.3)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 17.2)
    Trp_halogenase; Tryptophan halogenase (PF04820; HMM-score: 16.4)
    NAD_binding_8; NAD(P)-binding Rossmann-like domain (PF13450; HMM-score: 16)
    TrkA_N; TrkA-N domain (PF02254; HMM-score: 13.9)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 13.5)
    HI0933_like; HI0933-like protein (PF03486; HMM-score: 11.9)
    Pyr_redox_3; Pyridine nucleotide-disulphide oxidoreductase (PF13738; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.149
    • Ymax_pos: 11
    • Cmax: 0.119
    • Cmax_pos: 23
    • Smax: 0.258
    • Smax_pos: 5
    • Smean: 0.222
    • D: 0.178
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVSSLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFLVVAPGLQINWSSIKGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIKCGGAPMKIMYLAEDYFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVATFEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALGDASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDYNKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SAOUHSC_02298 (SigB*) [2] [3] other strains
    SigB* (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Jiangchuan Shen, Mary E Keithly, Richard N Armstrong, Khadine A Higgins, Katherine A Edmonds, David P Giedroc
Staphylococcus aureus CstB Is a Novel Multidomain Persulfide Dioxygenase-Sulfurtransferase Involved in Hydrogen Sulfide Detoxification.
Biochemistry: 2015, 54(29);4542-54
[PubMed:26177047] [WorldCat.org] [DOI] (I p)