From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00053
  • pan locus tag?: SAUPAN000859000
  • symbol: SAOUHSC_00053
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00053
  • symbol: SAOUHSC_00053
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 56284..57054
  • length: 771
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATAAAACGTGTAAATAAATTAGTGCTTGGTATTAGTCTTCTGTTTTTAGTCATTAGT
    ATCACTGCTGGTTGTGGCATGGGTAAAGAAGCGGAAATAAAGAAAAGTTTTGAAAAAACA
    TTGAGTATGTATCCGATTAAAAATCTAGAGGATTTATACGATAAAGAAGGATATCGTGAT
    GATCAATTTGATAAAAATGATAAGGGAACATGGATTGTAAATTCTCAAATGGCAATTCAA
    AATAAAGGAGAAGCTCTAAAAATAAAAGGCATGCTTTTGAAGATAGATAGAAATACAAGA
    AGTGCAAAAGGATTTTACTATACTAATGAAATAAAGACGGAGAAATACGAAGTAGCTCAG
    GATAATCAAAAAAAATATCCAGTTAAAATGATTAATAATAAATTCATTTCTACTGAGGAA
    GTTAAAGAAGAAAACATAAAAAAAGAAATCGAAAACTTTAAGTTTTTTGCGCAATATAGC
    AATTTTAAAGATTTAATGAATTATAAAGATGGAGATATATCATATAATCCAGAGGTGCCG
    AGTTATTCAGCTCAATATCAATTAACTAATGATGATTATAATGTAAAACAATTACGTAAA
    AGATATGACATACCAACAAATAAAGCGCCGAAGCTGTTGTTGAAAGGTACAGGGAATTTA
    AAAGGTTCATCAGTTGGATATAAAAAAATTGAATTTACTTTTTTAGAGAATAAAAATGAA
    AATATTTACTTTACTGATAGTCTACATCTTGAACCGAGCGAGGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    771

Protein[edit source | edit]

Protein Data Bank: 4BIG

General[edit source | edit]

  • locus tag: SAOUHSC_00053
  • symbol: SAOUHSC_00053
  • description: hypothetical protein
  • length: 256
  • theoretical pI: 9.41878
  • theoretical MW: 29790.8
  • GRAVY: -0.775391

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 372.3)
  • TheSEED:  
    FIG01107885: hypothetical protein 
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 412.7)
    no clan definedDUF2666; Protein of unknown function (DUF2666) (PF10869; HMM-score: 14.2)
    PulG; Type II secretory pathway pseudopilin (PF11773; HMM-score: 13.5)
    DUF4635; Domain of unknown function (DUF4635) (PF15466; HMM-score: 11.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: ITAGCGM
  • SignalP: Signal peptide length 29 aa
    • Ymax: 0.389
    • Ymax_pos: 29
    • Cmax: 0.25
    • Cmax_pos: 29
    • Smax: 0.813
    • Smax_pos: 13
    • Smean: 0.663
    • D: 0.496
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIKRVNKLVLGISLLFLVISITAGCGMGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRDDQFDKNDKGTWIVNSQMAIQNKGEALKIKGMLLKIDRNTRSAKGFYYTNEIKTEKYEVAQDNQKKYPVKMINNKFISTEEVKEENIKKEIENFKFFAQYSNFKDLMNYKDGDISYNPEVPSYSAQYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKKIEFTFLENKNENIYFTDSLHLEPSEDK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]