From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00086
  • pan locus tag?: SAUPAN000932000
  • symbol: SAOUHSC_00086
  • pan gene symbol?: butA
  • synonym:
  • product: acetoin reductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00086
  • symbol: SAOUHSC_00086
  • product: acetoin reductase
  • replicon: chromosome
  • strand: +
  • coordinates: 92458..93234
  • length: 777
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACAAACAACAAAGTAGCATTAGTAACTGGCGGAGCACAAGGGATTGGTTTTAAAATT
    GCAGAACGTTTAGTGGAAGATGGTTTCAAAGTAGCAGTTGTTGATTTCAATGAAGAAGGG
    GCAAAAGCAGCTGCACTTAAATTATCAAGTGATGGTACAAAAGCTATTGCTATCAAAGCA
    GATGTATCAAACCGTGATGATGTATTTAACGCAGTAAGACAAACTGCCGCGCAATTTGGC
    GATTTCCATGTCATGGTTAACAATGCCGGCCTTGGACCAACAACACCAATCGATACAATT
    ACTGAAGAACAGTTTAAAACAGTATATGGCGTGAACGTTGCAGGTGTGCTATGGGGTATT
    CAAGCCGCACATGAACAATTTAAAAAATTCAATCATGGCGGTAAAATTATCAATGCAACA
    TCTCAAGCAGGCGTTGAGGGTAACCCAGGCTTGTCTTTATATTGCAGTACAAAATTCGCA
    GTGCGAGGTTTAACACAAGTAGCCGCACAAGATTTAGCGTCTGAAGGTATTACTGTGAAT
    GCATTCGCACCTGGTATCGTTCAAACACCAATGATGGAAAGTATCGCAGTGGCAACAGCC
    GAAGAAGCAGGTAAACCTGAAGCATGGGGTTGGGAACAATTTACAAGTCAGATTGCTTTG
    GGCAGAGTTTCTCAACCAGAAGATGTTTCAAATGTAGTGAGCTTCTTAGCTGGTAAAGAC
    TCTGATTACATTACTGGACAAACAATTATTGTAGATGGTGGTATGAGATTCCGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    777

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00086
  • symbol: SAOUHSC_00086
  • description: acetoin reductase
  • length: 258
  • theoretical pI: 4.79367
  • theoretical MW: 27215.5
  • GRAVY: -0.0108527

Function[edit source | edit]

  • reaction:
    EC 1.1.1.100?  ExPASy
    3-oxoacyl-[acyl-carrier-protein] reductase(3R)-3-hydroxyacyl-[acyl-carrier-protein] + NADP+ = 3-oxoacyl-[acyl-carrier-protein] + NADPH
  • TIGRFAM:
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 418.5)
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 190.3)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 184.5)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 170.7)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 155.2)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 153.3)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 151.9)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 132.1)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 128.7)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 128.2)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 127.3)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 101.2)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 92.3)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 42.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-dependent protochlorophyllide reductase (TIGR01289; EC 1.3.1.33; HMM-score: 18.5)
    polyketide-type polyunsaturated fatty acid synthase PfaA (TIGR02813; HMM-score: 16.8)
    MetabolismEnergy metabolismSugarsUDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 16)
    NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family (TIGR04180; HMM-score: 14.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdTDP-glucose 4,6-dehydratase (TIGR01181; EC 4.2.1.46; HMM-score: 14.1)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesADP-glyceromanno-heptose 6-epimerase (TIGR02197; EC 5.1.3.20; HMM-score: 12.1)
  • TheSEED:  
    Acetoin, butanediol metabolism 2,3-butanediol dehydrogenase, S-alcohol forming, (R)-acetoin-specific (EC 1.1.1.4) / Acetoin (diacetyl) reductase (EC 1.1.1.304) 
  • PFAM:
    NADP_Rossmann (CL0063) adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 196.9)
    adh_short; short chain dehydrogenase (PF00106; HMM-score: 187.2)
    KR; KR domain (PF08659; HMM-score: 56)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 16.8)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 16.4)
    TrkA_N; TrkA-N domain (PF02254; HMM-score: 15.7)
    3HCDH_N; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain (PF02737; HMM-score: 15.1)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 15)
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 14.7)
    no clan definedDynein_attach_N; Dynein attachment factor N-terminus (PF15867; HMM-score: 14.6)
    Pec_lyase-like (CL0268) Pertactin; Pertactin (PF03212; HMM-score: 12.6)
    NADP_Rossmann (CL0063) GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 11.6)
    NmrA; NmrA-like family (PF05368; HMM-score: 10.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 11
    • Cmax: 0.145
    • Cmax_pos: 44
    • Smax: 0.253
    • Smax_pos: 1
    • Smean: 0.144
    • D: 0.134
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAVVDFNEEGAKAAALKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGGKIINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGKPEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGGMRFR

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]