From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00116
  • pan locus tag?: SAUPAN000976000
  • symbol: SAOUHSC_00116
  • pan gene symbol?: capC
  • synonym:
  • product: capsular polysaccharide biosynthesis protein Cap8C

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00116
  • symbol: SAOUHSC_00116
  • product: capsular polysaccharide biosynthesis protein Cap8C
  • replicon: chromosome
  • strand: +
  • coordinates: 120865..121629
  • length: 765
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATTGATATTCATAACCATATATTGCCTAATATCGATGACGGTCCGACAAATGAAACA
    GAGATGATGGATCTTTTAAAACAAGCGACAACACAAGGTGTTACAGAAATCATTGTAACA
    TCACATCACTTACATCCTCGATATACCACACCTATAGAAAAAGTGAAATCATGTTTAAAC
    CATATTGAAAGCTTAGAGGAAGTACAAGCACTAAATCTAAAGTTTTATTATGGTCAGGAA
    ATAAGAATTACCGATCAAATCCTTAATGATATTGATCGAAAAGTTATTAACGGTATTAAT
    GATTCACGCTATTTACTAATAGAATTTCCATCAAATGAAGTTCCACACTATACTGATCAA
    TTATTTTTCGAATTACAGAGTAAAGGCTTTGTACCGATTATTGCACATCCAGAGCGGAAT
    AAAGCAATAAGTCAAAACCTTGACATACTATACGATTTAATTAACAAAGGTGCTTTAAGT
    CAAGTGACAACGGCGTCATTAGCGGGTATTTCCGGTAAAAAAATTAGAAAATTAGCAATT
    CAAATGATTGAAAACAATCTGACACATTTCATCGGTTCAGATGCGCATAACACAGAAATC
    AGACCGTTCTTAATGAAAGACTTATTTAATGATAAGAAATTACGTGATTATTATGAAGAT
    ATGAACGGATTTATTAGTAATGCGAAGTTAGTTGTTGATGATAAAAAAATTCCTAAACGA
    ATGCCACAACAAGATTATAAACAGAAAAGATGGTTTGGGTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    765

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00116
  • symbol: SAOUHSC_00116
  • description: capsular polysaccharide biosynthesis protein Cap8C
  • length: 254
  • theoretical pI: 6.68319
  • theoretical MW: 29361.4
  • GRAVY: -0.439764

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionTranscription factorstranscription termination/antitermination factor NusG (TIGR00922; HMM-score: 13.1)
    Genetic information processingProtein synthesistRNA aminoacylationaspartate--tRNA(Asn) ligase (TIGR00458; EC 6.1.1.23; HMM-score: 12.1)
  • TheSEED:  
    Cell Wall and CapsuleCapsular and extracellular polysacchridesExopolysaccharide Biosynthesis Manganese-dependent protein-tyrosine phosphatase (EC 3.1.3.48) 
    Regulation and Cell signalingRegulation and Cell signaling - no subcategoryCell envelope-associated LytR-CpsA-Psr transcriptional attenuators Manganese-dependent protein-tyrosine phosphatase (EC 3.1.3.48) 
  • PFAM:
    Amidohydrolase (CL0034) PHP; PHP domain (PF02811; HMM-score: 14.3)
    no clan definedATP-synt_F; ATP synthase (F/14-kDa) subunit (PF01990; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.102
    • Ymax_pos: 35
    • Cmax: 0.107
    • Cmax_pos: 65
    • Smax: 0.132
    • Smax_pos: 43
    • Smean: 0.075
    • D: 0.091
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIDIHNHILPNIDDGPTNETEMMDLLKQATTQGVTEIIVTSHHLHPRYTTPIEKVKSCLNHIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVINGINDSRYLLIEFPSNEVPHYTDQLFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVTTASLAGISGKKIRKLAIQMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMNGFISNAKLVVDDKKIPKRMPQQDYKQKRWFGL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SAOUHSC_02298 (SigB*) [1] [2] other strains
    SigB* (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator: SAOUHSC_01228 (CodY*)
    CodY* (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  2. 2.0 2.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]