From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00427
  • pan locus tag?: SAUPAN002179000
  • symbol: SAOUHSC_00427
  • pan gene symbol?: sle1
  • synonym:
  • product: autolysin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00427
  • symbol: SAOUHSC_00427
  • product: autolysin
  • replicon: chromosome
  • strand: +
  • coordinates: 427609..428613
  • length: 1005
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    GTGCAAAAAAAAGTAATTGCAGCTATTATTGGGACAAGCGCGATTAGCGCTGTTGCGGCA
    ACTCAAGCAAATGCGGCTACAACTCACACAGTAAAACCGGGTGAATCAGTGTGGGCAATT
    TCAAATAAGTATGGGATTTCGATTGCTAAATTAAAGTCATTAAACAATTTAACATCTAAT
    CTAATTTTCCCAAACCAAGTACTAAAAGTATCTGGCTCAAGTAATTCTACGAGTAATAGT
    AGCCGTCCATCAACGAACTCAGGTGGCGGATCATACTACACAGTACAAGCAGGCGACTCA
    TTATCATTAATCGCATCAAAATATGGTACAACTTACCAAAACATTATGCGACTTAATGGT
    TTAAATAATTTCTTTATTTATCCAGGTCAAAAATTAAAAGTATCAGGTACTGCTAGCTCA
    AGTAACGCTGCGAGCAATAGTAGCCGTCCATCAACGAACTCAGGTGGCGGATCATACTAT
    ACAGTACAAGCAGGTGACTCATTGTCATTAATTGCATCAAAATATGGTACAACTTATCAA
    AAAATTATGAGCTTAAATGGCTTAAATAATTTCTTTATATATCCGGGTCAAAAATTGAAA
    GTAACTGGTAATGCATCTACGAACTCAGGATCTGCAACAACGACAAATAGAGGTTACAAT
    ACACCAGTATTCAGTCACCAAAACTTATATACATGGGGTCAATGTACATATCATGTATTT
    AATCGTCGTGCTGAAATTGGTAAAGGTATTAGTACTTATTGGTGGAATGCTAATAACTGG
    GATAACGCAGCGGCAGCAGATGGTTACACTATCGACAATAGACCTACTGTAGGTTCTATC
    GCTCAAACAGATGTAGGTTACTATGGTCATGTTATGTTTGTAGAACGTGTAAATAACGAT
    GGTAGTATTTTAGTTTCAGAAATGAACTATTCAGCTGCACCAGGTATTTTAACTTACAGA
    ACGGTACCAGCTTACCAAGTAAATAATTATAGATATATTCACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1005

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00427
  • symbol: SAOUHSC_00427
  • description: autolysin
  • length: 334
  • theoretical pI: 9.98873
  • theoretical MW: 35835.5
  • GRAVY: -0.326048

Function[edit source | edit]

  • reaction:
    EC 3.5.1.28?  ExPASy
    N-acetylmuramoyl-L-alanine amidaseHydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides
    EC 3.2.1.-?  ExPASy
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationspore coat assembly protein SafA (TIGR02899; HMM-score: 73.8)
    Cellular processesCellular processesSporulation and germinationstage VI sporulation protein D (TIGR02907; HMM-score: 35.4)
  • TheSEED:  
    Autolysin precursor 
  • PFAM:
    LysM (CL0187) LysM; LysM domain (PF01476; HMM-score: 166.3)
    Peptidase_CA (CL0125) CHAP; CHAP domain (PF05257; HMM-score: 49.4)
    no clan definedSPOR; Sporulation related domain (PF05036; HMM-score: 13.3)
    Attacin_C; Attacin, C-terminal region (PF03769; HMM-score: 11.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 10
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: TQANAATT
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.85
    • Ymax_pos: 26
    • Cmax: 0.844
    • Cmax_pos: 26
    • Smax: 0.953
    • Smax_pos: 19
    • Smean: 0.82
    • D: 0.838
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSNLIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNGLNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQKIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTPVFSHQNLYTWGQCTYHVFNRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNNDGSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]