From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00685
  • pan locus tag?: SAUPAN002561000
  • symbol: SAOUHSC_00685
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00685
  • symbol: SAOUHSC_00685
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 671375..671770
  • length: 396
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAGAAATTAATCATCAGTATTATGGCGGTCATGCTATTTTTAACAGGTTGTGGTAAA
    AGTCAAGAGAAAGCCACTCTGGAAAAGGATATCGATAATTTACAAAAAGAAAATAAAGAA
    TTAAAAGACAAAAAAGAAAAGCTTCAACAAGAAAAAGAAAAATTAGCAGATAAGCAAAAA
    GACCTTGAAAAAGAAGTGAAAGATTTAAAACCTTCAAAAGAAGATAACAAGGATGATAAA
    AAAGACGAAGACAAAAATAAAGACAAAGATAAAGATAAAGAGGCATCACAAGATAAGCAA
    TCAAAAGATCAAACTAAGTCATCGGATAAAGATAATCACAAAAAGCCTACATCAGCAGAT
    AAAGATCAAAAAGCTAATGACAAACACCAATCATAA
    60
    120
    180
    240
    300
    360
    396

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00685
  • symbol: SAOUHSC_00685
  • description: hypothetical protein
  • length: 131
  • theoretical pI: 9.36324
  • theoretical MW: 15188
  • GRAVY: -1.87863

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationtranscription factor, RsfA family (TIGR02894; HMM-score: 19.6)
    Signal transductionRegulatory functionsDNA interactionstranscription factor, RsfA family (TIGR02894; HMM-score: 19.6)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 19.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingouter membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 16.7)
    SH3 domain protein (TIGR04211; HMM-score: 9.6)
    Cellular processesCellular processesCell divisioncell division protein ZipA (TIGR02205; HMM-score: 7.9)
    Cellular processesCellular processesCell divisionchromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
    Genetic information processingDNA metabolismChromosome-associated proteinschromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsintegrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 5.7)
    type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 5.5)
    Genetic information processingTranscriptionDegradation of RNAribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 5.5)
    Cellular processesCellular processesCell divisionchromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
    Genetic information processingDNA metabolismChromosome-associated proteinschromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
    Cellular processesCellular processesCell divisioncell division protein FtsL (TIGR02209; HMM-score: 5.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingmembrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 5.1)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 4.2)
    Cellular processesCellular processesCell divisioncell division protein FtsN (TIGR02223; HMM-score: 4.1)
    Cellular processesCellular processesSporulation and germinationstage III sporulation protein AE (TIGR02829; HMM-score: 3.2)
  • TheSEED:  
    FIG01108219: hypothetical protein 
  • PFAM:
    no clan definedTolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 19.5)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 16.9)
    no clan definedIncA; IncA protein (PF04156; HMM-score: 14.6)
    Leu_zip; Leucine zipper (PF15294; HMM-score: 13.4)
    Striatin; Striatin family (PF08232; HMM-score: 12)
    DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 11.7)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 10)
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 9.3)
    no clan definedFmp27_WPPW; RNA pol II promoter Fmp27 protein domain (PF10359; HMM-score: 9.2)
    NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 9.1)
    BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 9)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 8.5)
    SlyX; SlyX (PF04102; HMM-score: 8.1)
    DDHD; DDHD domain (PF02862; HMM-score: 7.9)
    YabB; Initiation control protein YabA (PF06156; HMM-score: 7.9)
    MctB; Copper transport outer membrane protein, MctB (PF11382; HMM-score: 6.9)
    SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 6.8)
    ADIP; Afadin- and alpha -actinin-Binding (PF11559; HMM-score: 6.6)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 6.4)
    no clan definedMIP-T3; Microtubule-binding protein MIP-T3 (PF10243; HMM-score: 6.4)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 6.4)
    no clan definedSAPS; SIT4 phosphatase-associated protein (PF04499; HMM-score: 5.6)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 5.4)
    SLC12; Solute carrier family 12 (PF03522; HMM-score: 5.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LFLTGCG
  • SignalP: Signal peptide length 22 aa
    • Ymax: 0.408
    • Ymax_pos: 22
    • Cmax: 0.233
    • Cmax_pos: 26
    • Smax: 0.895
    • Smax_pos: 19
    • Smean: 0.771
    • D: 0.55
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSADKDQKANDKHQS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]