From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00719
  • pan locus tag?: SAUPAN002596000
  • symbol: SAOUHSC_00719
  • pan gene symbol?: queE
  • synonym:
  • product: 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00719
  • symbol: SAOUHSC_00719
  • product: 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE
  • replicon: chromosome
  • strand: -
  • coordinates: 703128..703841
  • length: 714
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAAATTCCTGTACTCGAAATATTCGGTCCAACCATTCAGGGTGAAGGTCGAGTA
    ATCGGTAGAAAAACGATGTTTGTGAGAACAGCTGGATGTGATTATCGCTGTAGCTGGTGT
    GATTCTGCATTTACTTGGGATGGTAGTGCTAAAGGCGATATAAAACTCATGACCGCTGAA
    GAAATTTATGATGAATTAAAACGAATTGGTGGCGATTTATTTAACCACGTTACAATTTCT
    GGTGGTAACCCAGCATTAATTAAAGGTATCCAAGAGTTAGTTGACTTATTTCAAGATAAA
    GGTATTTTCAGCGCACTGGAGACACAAGGCAGTAAATTCCAACCTTGGATGACACAAATT
    GATGATTTAACGATTAGTCCAAAACCACCAAGTTCAACTATGACACCTGATTTAAAAAAG
    TTAGATGAAGTGATTACACAATGCGTACCTTCATCATTAAACTTAAAAGTAGTTGTATTC
    GACGATAAAGATTATGATTTTGCCAAAATGATACACCACCGTTATCCAGATATTCCCTTC
    TATTTACAAGTTGGTAACCCATATTTATCAGACAGCGTAGATAATCATACCGAAAAGTTG
    TTAGAACGCTACGAGCAGTTGGTGGATTTAGTTATGCAAAGTAATGATATGAATCACGTT
    TATGTGTTACCACAACTTCATACATTACTTTGGAGCAATAAAAAAGGTGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00719
  • symbol: SAOUHSC_00719
  • description: 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE
  • length: 237
  • theoretical pI: 5.10847
  • theoretical MW: 26820.6
  • GRAVY: -0.253587

Function[edit source | edit]

  • reaction:
    EC 4.3.99.3?  ExPASy
    7-carboxy-7-deazaguanine synthase6-carboxy-5,6,7,8-tetrahydropterin = 7-carboxy-7-carbaguanine + NH3
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modification7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 382.7)
    and 33 more
    Genetic information processingProtein synthesistRNA and rRNA base modificationputative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 93.4)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 77.6)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04322; HMM-score: 55.2)
    7-carboxy-7-deazaguanine synthase (TIGR04508; EC 4.3.99.3; HMM-score: 46.8)
    Genetic information processingProtein fateProtein modification and repairanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    Genetic information processingProtein fateProtein modification and repairpyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    MetabolismEnergy metabolismAnaerobicpyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    Genetic information processingProtein fateProtein modification and repairanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 23.4)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 21)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercoenzyme PQQ biosynthesis enzyme PqqE (TIGR02109; HMM-score: 19)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinprobable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 19)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 19)
    Unknown functionEnzymes of unknown specificitymycofactocin radical SAM maturase (TIGR03962; HMM-score: 18.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 18.8)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 18.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 18.3)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 18)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 17.6)
    sporulation killing factor system radical SAM maturase (TIGR04403; HMM-score: 16.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 16.4)
    Unknown functionEnzymes of unknown specificityY_X(10)_GDL-associated radical SAM protein (TIGR03913; HMM-score: 16.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamin12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 16.2)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 15.4)
    selenobiotic family peptide radical SAM maturase (TIGR04082; HMM-score: 15.4)
    Genetic information processingProtein fateProtein modification and repair[benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 14.9)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 14)
    radical SAM/SPASM domain protein, ACGX system (TIGR04340; HMM-score: 13.3)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 12.7)
    putative peptide-modifying radical SAM enzyme, Mhun_1560 family (TIGR04083; HMM-score: 12.7)
  • TheSEED:  
    Queuosine-Archaeosine Biosynthesis 7-carboxy-7-deazaguanine synthase (EC 4.3.99.3) 
  • PFAM:
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 46.1)
    and 3 more
    4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 36.3)
    Fer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 33.3)
    no clan definedHistone_H2A_C; C-terminus of histone H2A (PF16211; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+, S-adenosyl-L-methionine, [4Fe-4S] cluster
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.107
    • Ymax_pos: 23
    • Cmax: 0.141
    • Cmax_pos: 53
    • Smax: 0.126
    • Smax_pos: 22
    • Smean: 0.097
    • D: 0.103
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAEEIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQIDDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPFYLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SAOUHSC_02298 regulon (SigB*) [3] other strains
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]