From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00804
  • pan locus tag?: SAUPAN002715000
  • symbol: smpB
  • pan gene symbol?: smpB
  • synonym:
  • product: SsrA-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00804
  • symbol: smpB
  • product: SsrA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 787743..788207
  • length: 465
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGCTAAGAAGAAATCACCAGGTACATTAGCGGAAAATCGTAAGGCAAGACATGATTAT
    AATATTGAAGATACGATTGAAGCGGGAATTGTATTGCAAGGCACAGAAATAAAATCAATT
    CGCCGAGGTAGTGCTAACCTTAAAGATAGTTATGCGCAAGTTAAAAACGGTGAAATGTAT
    TTGAATAATATGCATATAGCACCATACGAAGAAGGGAATCGTTTTAATCACGATCCTCTT
    CGTTCTCGAAAATTATTATTGCACAAGCGTGAAATCATTAAATTGGGTGATCAAACACGT
    GAGATTGGTTATTCGATTGTGCCGTTAAAGCTTTATTTGAAGCATGGACATTGTAAAGTA
    TTACTTGGTGTTGCACGAGGTAAGAAAAAATATGATAAACGTCAAGCTTTGAAAGAAAAA
    GCAGTCAAACGAGATGTTGCGCGCGATATGAAAGCCCGTTATTAA
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00804
  • symbol: SmpB
  • description: SsrA-binding protein
  • length: 154
  • theoretical pI: 10.6419
  • theoretical MW: 17755.5
  • GRAVY: -0.857143

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisOtherSsrA-binding protein (TIGR00086; HMM-score: 194.9)
  • TheSEED:  
    Phages, Prophages, Transposable elements, PlasmidsPathogenicity islandsStaphylococcal pathogenicity islands SaPI tmRNA-binding protein SmpB 
    Protein MetabolismProtein biosynthesisTranslation termination factors bacterial tmRNA-binding protein SmpB 
    Protein biosynthesisTrans-translation by stalled ribosomes tmRNA-binding protein SmpB 
    Stress ResponseHeat shockHeat shock dnaK gene cluster extended tmRNA-binding protein SmpB 
  • PFAM:
    no clan definedSmpB; SmpB protein (PF01668; HMM-score: 206.6)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.143
    • Ymax_pos: 11
    • Cmax: 0.12
    • Cmax_pos: 53
    • Smax: 0.364
    • Smax_pos: 1
    • Smean: 0.159
    • D: 0.149
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSANLKDSYAQVKNGEMYLNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIIKLGDQTREIGYSIVPLKLYLKHGHCKVLLGVARGKKKYDKRQALKEKAVKRDVARDMKARY

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53

Relevant publications[edit source | edit]