From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00861
  • pan locus tag?: SAUPAN003022000
  • symbol: SAOUHSC_00861
  • pan gene symbol?: lipA
  • synonym:
  • product: lipoyl synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00861
  • symbol: SAOUHSC_00861
  • product: lipoyl synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 829617..830534
  • length: 918
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGGCGACAAAAAACGAGGAAATATTACGTAAACCGGATTGGTTGAAAATAAAATTAAAT
    ACCAACGAAAACTATACAGGACTTAAGAAGATGATGAGGGAAAAAAATCTTAATACTGTA
    TGTGAAGAAGCTAAATGTCCTAATATACATGAATGTTGGGGTGCACGTCGTACAGCGACA
    TTTATGATTTTAGGTGCCGTATGTACAAGAGCTTGTCGTTTTTGTGCGGTTAAGACAGGT
    TTACCTAATGAACTTGATTTAAATGAGCCTGAACGTGTAGCTGAATCAGTTGAATTAATG
    AATTTGAAACACGTTGTTATCACTGCTGTTGCGCGTGATGATTTAAGAGATGCTGGTTCA
    AATGTTTATGCTGAGACAGTACGTAAAGTTAGAGAAAGAAATCCATTTACAACGATTGAA
    ATTTTACCATCAGATATGGGCGGGGACTATGATGCGTTAGAAACATTAATGGCGTCAAGA
    CCTGACATTTTAAACCATAATATTGAAACTGTTCGTCGCTTAACACCGAGAGTTCGTGCG
    CGTGCGACTTACGACAGAACATTAGAGTTTTTACGTCGTTCAAAAGAATTACAACCGGAT
    ATCCCAACTAAATCAAGTATTATGGTTGGATTAGGTGAAACTATAGAAGAAATTTATGAA
    ACGATGGATGATTTACGTGCGAATGATGTAGATATTTTAACGATTGGTCAATATTTACAA
    CCTTCACGTAAACATTTAAAGGTTCAAAAATATTACACGCCTTTAGAGTTTGGTAAATTA
    AGAAAAGTGGCAATGGATAAAGGGTTTAAACATTGCCAAGCTGGACCTTTAGTACGTAGT
    TCTTATCATGCGGATGAGCAAGTAAATGAAGCTGCTAAAGAAAAGCAACGCCAAGGTGAG
    GCACAGTTAAATAGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    918

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00861
  • symbol: SAOUHSC_00861
  • description: lipoyl synthase
  • length: 305
  • theoretical pI: 8.26846
  • theoretical MW: 34884.8
  • GRAVY: -0.598033

Function[edit source | edit]

  • reaction:
    EC 2.8.1.8?  ExPASy
    Lipoyl synthaseProtein N6-(octanoyl)lysine + 2 sulfur-(sulfur carrier) + 2 S-adenosyl-L-methionine + 2 reduced [2Fe-2S] ferredoxin = protein N6-(lipoyl)lysine + 2 (sulfur carrier) + 2 L-methionine + 2 5'-deoxyadenosine + 2 oxidized [2Fe-2S] ferredoxin
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersLipoatelipoyl synthase (TIGR00510; EC 2.8.1.8; HMM-score: 400.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinbiotin synthase (TIGR00433; EC 2.8.1.6; HMM-score: 34.8)
    Unknown functionEnzymes of unknown specificityradical SAM protein, MSMEG_0568 family (TIGR04043; HMM-score: 24.2)
    radical SAM methylthiotransferase, MiaB/RimO family (TIGR00089; EC 2.1.1.-,2.8.1.-; HMM-score: 15.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit (TIGR03550; EC 2.5.1.77; HMM-score: 14.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit (TIGR03551; EC 2.5.1.77; HMM-score: 14.3)
    Hypothetical proteinsConservedradical SAM domain protein, CofH subfamily (TIGR00423; HMM-score: 13.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonedehypoxanthine futalosine cyclase (TIGR03699; HMM-score: 13.5)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein S12 methylthiotransferase RimO (TIGR01125; EC 2.1.1.-,2.8.1.-; HMM-score: 12.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiazole biosynthesis protein ThiH (TIGR02351; HMM-score: 11.6)
  • TheSEED:  
    Lipoic acid metabolism Lipoyl synthase (EC 2.8.1.8) 
  • PFAM:
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 51.4)
    no clan definedLIAS_N; N-terminal domain of lipoyl synthase of Radical_SAM family (PF16881; HMM-score: 42.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: [4Fe-4S] cluster
  • effectors:
  • protein partners:
    SAOUHSC_00503UvrB/UvrC motif-containing protein  [1] (data from MRSA252)
    SAOUHSC_00504ATP:guanido phosphotransferase  [1] (data from MRSA252)
    SAOUHSC_00679hypothetical protein  [1] (data from MRSA252)
    SAOUHSC_01819hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 11
    • Cmax: 0.104
    • Cmax_pos: 56
    • Smax: 0.215
    • Smax_pos: 4
    • Smean: 0.17
    • D: 0.144
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MATKNEEILRKPDWLKIKLNTNENYTGLKKMMREKNLNTVCEEAKCPNIHECWGARRTATFMILGAVCTRACRFCAVKTGLPNELDLNEPERVAESVELMNLKHVVITAVARDDLRDAGSNVYAETVRKVRERNPFTTIEILPSDMGGDYDALETLMASRPDILNHNIETVRRLTPRVRARATYDRTLEFLRRSKELQPDIPTKSSIMVGLGETIEEIYETMDDLRANDVDILTIGQYLQPSRKHLKVQKYYTPLEFGKLRKVAMDKGFKHCQAGPLVRSSYHADEQVNEAAKEKQRQGEAQLNS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  4. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]