From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01039
  • pan locus tag?: SAUPAN003316000
  • symbol: SAOUHSC_01039
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01039
  • symbol: SAOUHSC_01039
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1007610..1008236
  • length: 627
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAATTTGGAAAAACAATCGCAGTAGTATTAGCATCTAGTGTCTTGCTTGCAGGATGT
    ACTACGGATAAAAAAGAAATTAAGGCATATTTAAAGCAAGTGGATAAAATTAAAGATGAT
    GAAGAACCAATTAAAACTGTTGGTAAGAAAATTGCTGAATTAGATGAGAAAAAGAAAAAA
    TTAACTGAAGATGTCAATAGTAAAGATACAGCAGTTCGCGGTAAAGCAGTAAAGGATTTA
    ATTAAAAATGCCGATGATCGTCTAAAGGAATTTGAAAAAGAAGAAGACGCAATTAAGAAG
    TCTGAACAAGACTTTAAGAAAGCAAAAAGTCACGTTGATAACATTGATAATGATGTTAAA
    CGTAAAGAAGTAAAACAATTAGATGATGTATTAAAAGAAAAATATAAGTTACACAGTGAT
    TACGCGAAAGCATATAAAAAGGCTGTAAACTCAGAGAAAACATTATTTAAATATTTAAAT
    CAAAATGACGCGACACAACAAGGTGTTAACGAAAAATCAAAAGCAATAGAACAGAACTAT
    AAAAAGTTAAAAGAAGTATCAGATAAGTATACAAAAGTACTAAATAAGGTTGGTAAAGAA
    AAGCAAGACGTTGATCAATTTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01039
  • symbol: SAOUHSC_01039
  • description: hypothetical protein
  • length: 208
  • theoretical pI: 9.96393
  • theoretical MW: 23875.2
  • GRAVY: -1.06587

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesCell divisionchromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)
    Genetic information processingDNA metabolismChromosome-associated proteinschromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 12.8)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)
    SH3 domain protein (TIGR04211; HMM-score: 8.1)
    two transmembrane protein (TIGR04527; HMM-score: 7.7)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsconjugative transfer region lipoprotein, TIGR03751 family (TIGR03751; HMM-score: 5.9)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.2)
  • TheSEED:  
    FIG01108153: hypothetical protein 
  • PFAM:
    no clan definedYkyA; Putative cell-wall binding lipoprotein (PF10368; HMM-score: 171)
    Mce4_CUP1; Cholesterol uptake porter CUP1 of Mce4, putative (PF11887; HMM-score: 18.6)
    Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 14.1)
    BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 12.5)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 12.3)
    no clan definedBORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 12.3)
    IL31; Interleukin 31 (PF15209; HMM-score: 11.7)
    TerB (CL0414) TerB; Tellurite resistance protein TerB (PF05099; HMM-score: 11.6)
    no clan definedEzrA; Septation ring formation regulator, EzrA (PF06160; HMM-score: 11.2)
    DASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 10.4)
    DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 9.9)
    T3SSipB; Type III cell invasion protein SipB (PF16535; HMM-score: 9.8)
    CENP-H; Centromere protein H (CENP-H) (PF05837; HMM-score: 9)
    P-loop_NTPase (CL0023) AAA_13; AAA domain (PF13166; HMM-score: 8.7)
    Golgi-transport (CL0145) BAR_3; BAR domain of APPL family (PF16746; HMM-score: 7)
    no clan definedIncA; IncA protein (PF04156; HMM-score: 6.8)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: VLLAGCT
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.344
    • Ymax_pos: 26
    • Cmax: 0.2
    • Cmax_pos: 26
    • Smax: 0.793
    • Smax_pos: 6
    • Smean: 0.669
    • D: 0.471
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFGKTIAVVLASSVLLAGCTTDKKEIKAYLKQVDKIKDDEEPIKTVGKKIAELDEKKKKLTEDVNSKDTAVRGKAVKDLIKNADDRLKEFEKEEDAIKKSEQDFKKAKSHVDNIDNDVKRKEVKQLDDVLKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVGKEKQDVDQFK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]