From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01121
  • pan locus tag?: SAUPAN003418000
  • symbol: SAOUHSC_01121
  • pan gene symbol?: hla
  • synonym:
  • product: alpha-hemolysin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01121
  • symbol: SAOUHSC_01121
  • product: alpha-hemolysin
  • replicon: chromosome
  • strand: -
  • coordinates: 1076413..1077372
  • length: 960
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAAACACGTATAGTCAGCTCAGTAACAACAACACTATTGCTAGGTTCCATATTAATG
    AATCCTGTCGCTAATGCCGCAGATTCTGATATTAATATTAAAACCGGTACTACAGATATT
    GGAAGCAATACTACAGTAAAAACAGGTGATTTAGTCACTTATGATAAAGAAAATGGCATG
    CACAAAAAAGTATTTTATAGTTTTATCGATGATAAAAATCATAATAAAAAACTGCTAGTT
    ATTAGAACGAAAGGTACCATTGCTGGTCAATATAGAGTTTATAGCGAAGAAGGTGCTAAC
    AAAAGTGGTTTAGCCTGGCCTTCAGCCTTTAAGGTACAGTTGCAACTACCTGATAATGAA
    GTAGCTCAAATATCTGATTACTATCCAAGAAATTCGATTGATACAAAAGAGTATATGAGT
    ACTTTAACTTATGGATTCAACGGTAATGTTACTGGTGATGATACAGGAAAAATTGGCGGC
    CTTATTGGTGCAAATGTTTCGATTGGTCATACACTGAAATATGTTCAACCTGATTTCAAA
    ACAATTTTAGAGAGCCCAACTGATAAAAAAGTAGGCTGGAAAGTGATATTTAACAATATG
    GTGAATCAAAATTGGGGACCATATGATAGAGATTCTTGGAACCCGGTATATGGCAATCAA
    CTTTTCATGAAAACTAGAAATGGCTCTATGAAAGCAGCAGATAACTTCCTTGATCCTAAC
    AAAGCAAGTTCTCTATTATCTTCAGGGTTTTCACCAGACTTCGCTACAGTTATTACTATG
    GATAGAAAAGCATCCAAACAACAAACAAATATAGATGTAATATACGAACGAGTTCGTGAT
    GACTACCAATTGCACTGGACTTCAACAAATTGGAAAGGTACCAATACTAAAGATAAATGG
    ATAGATCGTTCTTCAGAAAGATATAAAATCGATTGGGAAAAAGAAGAAATGACAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960

Protein[edit source | edit]

Protein Data Bank: 4U6V

General[edit source | edit]

  • locus tag: SAOUHSC_01121
  • symbol: SAOUHSC_01121
  • description: alpha-hemolysin
  • length: 319
  • theoretical pI: 9.18585
  • theoretical MW: 35973.1
  • GRAVY: -0.645768

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistancebeta-channel forming cytolysin (TIGR01002; HMM-score: 436.1)
    CXXX repeat peptide modification system protein (TIGR04116; HMM-score: 11.5)
  • TheSEED:  
    Virulence, Disease and DefenseToxins and superantigensStaphylococcus Two-component and Pore-forming Cytolysins Alpha-hemolysin precursor 
  • PFAM:
    Leukocidin (CL0636) Leukocidin; Leukocidin/Hemolysin toxin family (PF07968; HMM-score: 277.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: PVANAADS
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.811
    • Ymax_pos: 27
    • Cmax: 0.755
    • Cmax_pos: 27
    • Smax: 0.909
    • Smax_pos: 18
    • Smean: 0.857
    • D: 0.829
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKTRIVSSVTTTLLLGSILMNPVANAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Radu Stefureac, Yi-Tao Long, Heinz-Bernhard Kraatz, Peter Howard, Jeremy S Lee
Transport of alpha-helical peptides through alpha-hemolysin and aerolysin pores.
Biochemistry: 2006, 45(30);9172-9
[PubMed:16866363] [WorldCat.org] [DOI] (P p)
Robin R Craven, Xi Gao, Irving C Allen, Denis Gris, Juliane Bubeck Wardenburg, Erin McElvania-Tekippe, Jenny P Ting, Joseph A Duncan
Staphylococcus aureus alpha-hemolysin activates the NLRP3-inflammasome in human and mouse monocytic cells.
PLoS ONE: 2009, 4(10);e7446
[PubMed:19826485] [WorldCat.org] [DOI] (I e)
Mark J J B Sibbald, Theresa Winter, Magdalena M van der Kooi-Pol, G Buist, E Tsompanidou, Tjibbe Bosma, Tina Schäfer, Knut Ohlsen, Michael Hecker, Haike Antelmann, Susanne Engelmann, Jan Maarten van Dijl
Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.
J. Bacteriol.: 2010, 192(14);3788-800
[PubMed:20472795] [WorldCat.org] [DOI] (I p)
Yoshikazu Tanaka, Nagisa Hirano, Jun Kaneko, Yoshiyuki Kamio, Min Yao, Isao Tanaka
2-Methyl-2,4-pentanediol induces spontaneous assembly of staphylococcal α-hemolysin into heptameric pore structure.
Protein Sci.: 2011, 20(2);448-56
[PubMed:21280135] [WorldCat.org] [DOI] (I p)