From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01316
  • pan locus tag?: SAUPAN003694000
  • symbol: SAOUHSC_01316
  • pan gene symbol?: nucI
  • synonym:
  • product: thermonuclease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01316
  • symbol: SAOUHSC_01316
  • product: thermonuclease
  • replicon: chromosome
  • strand: +
  • coordinates: 1259356..1259889
  • length: 534
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAGTCAAATAAATCGCTTGCTATGATTGTGGTAGCCATCATTATTGTAGGTGTATTA
    GCATTTCAATTTATGAATCATACGGGTCCTTTCAAAAAGGGGACGAATCATGAAACTGTA
    CAAGATTTAAATGGTAAAGATAAAGTACATGTTCAAAGAGTTGTGGATGGTGATACATTT
    ATTGCAAATCAAAATGGTAAAGAAATTAAAGTTAGGCTTATAGGGGTTGATACGCCAGAA
    ACGGTGAAACCGAATACGCCTGTACAACCATTTGGCAAAGAAGCATCAAATTATAGTAAG
    AAGACATTAACAAATCAAGATGTTTATTTAGAATATGATAAAGAAAAACAAGATCGCTAT
    GGTAGAACATTGGCGTATGTATGGATAAGTAAAGATCGTATGTACAATAAGGAATTAGTG
    GAAAAGGGACTTGCTAGAGAGAAGTATTTTTCACCAAATGGCAAATATAGAAATGTATTT
    ATAGAAGCACAAAATAAAGCTAAACAACAGAAATTAAATATTTGGAGTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    534

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01316
  • symbol: SAOUHSC_01316
  • description: thermonuclease
  • length: 177
  • theoretical pI: 10.2676
  • theoretical MW: 20328.2
  • GRAVY: -0.69096

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Thermonuclease 
  • PFAM:
    Tudor (CL0049) SNase; Staphylococcal nuclease homologue (PF00565; HMM-score: 113.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.308
    • Ymax_pos: 31
    • Cmax: 0.155
    • Cmax_pos: 34
    • Smax: 0.81
    • Smax_pos: 21
    • Smean: 0.669
    • D: 0.449
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKSNKSLAMIVVAIIIVGVLAFQFMNHTGPFKKGTNHETVQDLNGKDKVHVQRVVDGDTFIANQNGKEIKVRLIGVDTPETVKPNTPVQPFGKEASNYSKKTLTNQDVYLEYDKEKQDRYGRTLAYVWISKDRMYNKELVEKGLAREKYFSPNGKYRNVFIEAQNKAKQQKLNIWSK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAOUHSC_01316 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]