From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01373
  • pan locus tag?: SAUPAN003769000
  • symbol: SAOUHSC_01373
  • pan gene symbol?: femA
  • synonym:
  • product: methicillin resistance factor FemA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01373
  • symbol: SAOUHSC_01373
  • product: methicillin resistance factor FemA
  • replicon: chromosome
  • strand: +
  • coordinates: 1317076..1318338
  • length: 1263
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    ATGAAGTTTACAAATTTAACAGCTAAAGAGTTTGGTGCCTTTACAGATAGCATGCCATAC
    AGTCATTTCACGCAAACTGTTGGCCACTATGAGTTAAAGCTTGCTGAAGGTTATGAAACA
    CATTTAGTGGGAATAAAAAACAATAATAACGAGGTCATTGCAGCTTGCTTACTTACTGCT
    GTACCTGTTATGAAAGTGTTCAAGTATTTTTATTCAAATCGCGGTCCAGTGATTGATTAT
    GAAAATCAAGAACTCGTACACTTTTTCTTTAATGAATTATCAAAATATGTTAAAAAACAT
    CGTTGTCTATACCTACATATCGATCCATATTTACCATATCAATACTTGAATCATGATGGC
    GAGATTACAGGTAATGCTGGTAATGATTGGTTCTTTGATAAAATGAGTAACTTAGGATTT
    GAACATACTGGATTCCATAAAGGATTTGATCCTGTGCTACAAATTCGTTATCACTCAGTG
    TTAGATTTAAAAGATAAAACAGCAGATGACATCATTAAAAATATGGATGGACTTAGAAAA
    AGAAACACGAAAAAAGTTAAAAAGAATGGTGTTAAAGTAAGATTTTTATCTGAAGAAGAA
    CTACCAATTTTTAGATCATTTATGGAAGATACGTCAGAATCAAAAGCTTTTGCTGATCGT
    GATGACAAATTTTACTACAATCGCTTAAAATATTACAAAGACCGTGTGTTAGTACCTTTA
    GCGTATATCAACTTTGATGAATATATTAAAGAACTAAACGAAGAGCGTGATATTTTAAAT
    AAAGATTTAAATAAAGCGTTAAAGGATATTGAAAAACGTCCTGAAAATAAAAAAGCACAT
    AACAAGCGAGATAACTTACAACAACAACTTGATGCAAATGAGCAAAAGATTGAAGAAGGT
    AAACGTCTACAAGAAGAACATGGTAATGAATTACCTATCTCTGCTGGTTTCTTCTTTATC
    AATCCATTTGAAGTTGTTTATTATGCTGGTGGTACATCAAATGCATTCCGTCATTTTGCC
    GGAAGTTATGCAGTGCAATGGGAAATGATTAATTATGCATTAAATCATGGCATTGACCGT
    TATAATTTCTATGGTGTTAGTGGTAAATTTACAGAAGATGCTGAAGATGCTGGTGTAGTT
    AAATTCAAAAAAGGTTACAATGCTGAAATTATTGAATATGTTGGTGACTTTATTAAACCA
    ATTAATAAACCTGTTTACGCAGCATATACCGCACTTAAAAAAGTTAAAGACAGAATTTTT
    TAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1263

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01373
  • symbol: SAOUHSC_01373
  • description: methicillin resistance factor FemA
  • length: 420
  • theoretical pI: 7.48443
  • theoretical MW: 49123.3
  • GRAVY: -0.614762

Function[edit source | edit]

  • reaction:
    EC 2.3.2.17?  ExPASy
    N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N6-glycyl)-D-alanyl-D-alanine-diphosphoundecaprenyl-N-acetylglucosamine:glycine glycyltransferaseMurNAc-L-Ala-D-isoglutaminyl-L-Lys-(N6-Gly)-D-Ala-D-Ala-diphospho-ditrans,octacis-undecaprenyl-GlcNAc + 2 glycyl-tRNA = MurNAc-L-Ala-D-isoglutaminyl-L-Lys-(N6-tri-Gly)-D-Ala-D-Ala-diphospho-ditrans,octacis-undecaprenyl-GlcNAc + 2 tRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligase (TIGR00414; EC 6.1.1.11; HMM-score: 7.5)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage major capsid protein, HK97 family (TIGR01554; HMM-score: 4.1)
  • TheSEED:  
    Cell Wall and CapsuleCell Wall and Capsule - no subcategorytRNA-dependent amino acid transfers tRNA-dependent lipid II-Gly--glycine ligase 
    Cell Wall and Capsule - no subcategorytRNA-dependent amino acid transfers tRNA-dependent lipid II-GlyGly--glycine ligase 
    tRNA-dependent amino acid transfers FemA, factor essential for methicillin resistance 
  • PFAM:
    Acetyltrans (CL0257) FemAB; FemAB family (PF02388; HMM-score: 509)
    Acetyltransf_6; Acetyltransferase (GNAT) domain (PF13480; HMM-score: 16.2)
    no clan definedFlxA; FlxA-like protein (PF14282; HMM-score: 11.5)
    FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 7.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.124
    • Ymax_pos: 38
    • Cmax: 0.119
    • Cmax_pos: 55
    • Smax: 0.189
    • Smax_pos: 1
    • Smean: 0.127
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFTNLTAKEFGAFTDSMPYSHFTQTVGHYELKLAEGYETHLVGIKNNNNEVIAACLLTAVPVMKVFKYFYSNRGPVIDYENQELVHFFFNELSKYVKKHRCLYLHIDPYLPYQYLNHDGEITGNAGNDWFFDKMSNLGFEHTGFHKGFDPVLQIRYHSVLDLKDKTADDIIKNMDGLRKRNTKKVKKNGVKVRFLSEEELPIFRSFMEDTSESKAFADRDDKFYYNRLKYYKDRVLVPLAYINFDEYIKELNEERDILNKDLNKALKDIEKRPENKKAHNKRDNLQQQLDANEQKIEEGKRLQEEHGNELPISAGFFFINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGKFTEDAEDAGVVKFKKGYNAEIIEYVGDFIKPINKPVYAAYTALKKVKDRIF

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Susanne Rohrer, Brigitte Berger-Bächi
Application of a bacterial two-hybrid system for the analysis of protein-protein interactions between FemABX family proteins.
Microbiology (Reading, Engl.): 2003, 149(Pt 10);2733-8
[PubMed:14523106] [WorldCat.org] [DOI] (P p)
Tanja Schneider, Maria Magdalena Senn, Brigitte Berger-Bächi, Alessandro Tossi, Hans-Georg Sahl, Imke Wiedemann
In vitro assembly of a complete, pentaglycine interpeptide bridge containing cell wall precursor (lipid II-Gly5) of Staphylococcus aureus.
Mol. Microbiol.: 2004, 53(2);675-85
[PubMed:15228543] [WorldCat.org] [DOI] (P p)
Shasad Sharif, Sung Joon Kim, Harald Labischinski, Jiawei Chen, Jacob Schaefer
Uniformity of glycyl bridge lengths in the mature cell walls of fem mutants of methicillin-resistant Staphylococcus aureus.
J. Bacteriol.: 2013, 195(7);1421-7
[PubMed:23335411] [WorldCat.org] [DOI] (I p)
S Johnson, D Krüger, H Labischinski
FemA of Staphylococcus aureus: isolation and immunodetection.
FEMS Microbiol. Lett.: 1995, 132(3);221-8
[PubMed:7590176] [WorldCat.org] (P p)
A M Strandén, K Ehlert, H Labischinski, B Berger-Bächi
Cell wall monoglycine cross-bridges and methicillin hypersusceptibility in a femAB null mutant of methicillin-resistant Staphylococcus aureus.
J. Bacteriol.: 1997, 179(1);9-16
[PubMed:8981974] [WorldCat.org] (P p)
K Ehlert, W Schröder, H Labischinski
Specificities of FemA and FemB for different glycine residues: FemB cannot substitute for FemA in staphylococcal peptidoglycan pentaglycine side chain formation.
J. Bacteriol.: 1997, 179(23);7573-6
[PubMed:9393725] [WorldCat.org] (P p)