From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01637
  • pan locus tag?: SAUPAN004118000
  • symbol: SAOUHSC_01637
  • pan gene symbol?: comGF
  • synonym:
  • product: competence protein ComGF

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01637
  • symbol: SAOUHSC_01637
  • product: competence protein ComGF
  • replicon: chromosome
  • strand: -
  • coordinates: 1556824..1557321
  • length: 498
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATC
    AAAAGACATGTATACAGTATTAATGTCAAAGCTTTTTCGCTCATTGAAATGTTAGTAGCG
    ATGATGGTTATAAGTATAACTTTACTAATTGTTCCAGACTTAATTAGACTTAGTAAAACT
    TTTCTAATTGAAAGTAGGGATTTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT
    CTAGATGATTTTAAAGGAGTAGATAGAAACGATATTGAAATTAGGCAACACCGTATCATT
    TTACATAAAGGTGAAGAAATGATCGAATACAAATTAATTAATAATAAAATTATTAAAGTT
    GTAAATGACAGAGGAAATATAACAATGATTAATAATGTTACAGCATTTACTGCAAATATC
    TACTATAAATCCATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATGTGCAGACT
    AAAACTATTTATGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    498

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01637
  • symbol: SAOUHSC_01637
  • description: competence protein ComGF
  • length: 165
  • theoretical pI: 10.2218
  • theoretical MW: 19164.7
  • GRAVY: 0.324848

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeSurface structuresprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 22.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 22.6)
    Cell structureCell envelopeSurface structurestype IV pilus modification protein PilV (TIGR02523; HMM-score: 16.8)
    Genetic information processingProtein fateProtein modification and repairtype IV pilus modification protein PilV (TIGR02523; HMM-score: 16.8)
    Cell structureCell envelopeSurface structuresVerru_Chthon cassette protein C (TIGR02599; HMM-score: 13.6)
  • TheSEED:  
    DNA MetabolismDNA uptake, competenceLate competence Late competence protein ComGF, access of DNA to ComEA, FIG017774 
  • PFAM:
    no clan definedComGF; Putative Competence protein ComGF (PF15980; HMM-score: 39.2)
    N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 26)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.154
    • Ymax_pos: 13
    • Cmax: 0.115
    • Cmax_pos: 58
    • Smax: 0.251
    • Smax_pos: 4
    • Smean: 0.233
    • D: 0.185
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKTFLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQTKTIYV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]