From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01888
  • pan locus tag?: SAUPAN004457000
  • symbol: SAOUHSC_01888
  • pan gene symbol?: ribB
  • synonym:
  • product: riboflavin synthase subunit alpha

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01888
  • symbol: SAOUHSC_01888
  • product: riboflavin synthase subunit alpha
  • replicon: chromosome
  • strand: -
  • coordinates: 1800280..1800912
  • length: 633
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTTTACTGGCATCGTTGAAGAAATAGGTGTCGTTAAAAGTGTTCAAATTCGTCAATCA
    GTCAGGACGATTGAAATTGAAGCACATAAGATTACGGCAGATATGCATATTGGTGATTCC
    ATCAGTGTTAATGGTGCATGTTTAACAGTGATTGATTTTAATCAGACATCTTTTACTGTT
    CAAGTAATTAAAGGCACTGAAAATAAAACCTATTTAGCAGATGTTAAGCGACAATCAGAA
    GTAAATTTAGAGCGTGCCATGAGTGGTAACGGTAGGTTTGGTGGACATTTTGTCCTCGGT
    CATGTAGATGAACTAGGAACAGTTTCAAAAATAAATGAAACAGCCAATGCAAAAATTATT
    ACGATTCAATGTAGCCAACATATTAATAATCAGTTAGTTAAGCAAGGGTCTATTACTGTG
    GATGGTGTTAGTCTAACGGTATTTGATAAGCATGATAACAGTTTTGACATTCATCTTATT
    CCAGAAACGAGGCGTTCAACGATTTTATCATCCAAAAAATTAGGAGATAAAGTACATTTA
    GAAACAGACGTTTTGTTTAAATATGTTGAAAATATTTTAAATAAAGATAAAGACCAATTA
    TCTGTAGATAAATTAAGAGCATTTGGTTTTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    633

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01888
  • symbol: SAOUHSC_01888
  • description: riboflavin synthase subunit alpha
  • length: 210
  • theoretical pI: 6.96174
  • theoretical MW: 23298.4
  • GRAVY: -0.160476

Function[edit source | edit]

  • reaction:
    EC 2.5.1.9?  ExPASy
    Riboflavin synthase2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersRiboflavin, FMN, and FADriboflavin synthase, alpha subunit (TIGR00187; EC 2.5.1.9; HMM-score: 217.3)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsRiboflavin, FMN, FADriboflavin to FAD Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9) 
    Riboflavin, FMN, FADRiboflavin, FMN and FAD metabolism Extended Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9) 
  • PFAM:
    FAD_Lum_binding (CL0076) Lum_binding; Lumazine binding domain (PF00677; HMM-score: 144.1)
    DHFred (CL0387) RibD_C; RibD C-terminal domain (PF01872; HMM-score: 14)
    no clan definedUAE_UbL; Ubiquitin/SUMO-activating enzyme ubiquitin-like domain (PF14732; HMM-score: 13.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.13
    • Ymax_pos: 29
    • Cmax: 0.132
    • Cmax_pos: 66
    • Smax: 0.249
    • Smax_pos: 28
    • Smean: 0.11
    • D: 0.122
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFTGIVEEIGVVKSVQIRQSVRTIEIEAHKITADMHIGDSISVNGACLTVIDFNQTSFTVQVIKGTENKTYLADVKRQSEVNLERAMSGNGRFGGHFVLGHVDELGTVSKINETANAKIITIQCSQHINNQLVKQGSITVDGVSLTVFDKHDNSFDIHLIPETRRSTILSSKKLGDKVHLETDVLFKYVENILNKDKDQLSVDKLRAFGF

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]