From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01936
  • pan locus tag?: SAUPAN004561000
  • symbol: SAOUHSC_01936
  • pan gene symbol?: splE
  • synonym:
  • product: serine protease SplE

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01936
  • symbol: SAOUHSC_01936
  • product: serine protease SplE
  • replicon: chromosome
  • strand: -
  • coordinates: 1843316..1844032
  • length: 717
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAATAAAAATATAATCATCAAAAGTATTGCAGCATTGACGATTTTAACATCAGTGACT
    GGCGTCGGCACAACAGTGGTTGAGGGTATTCAACAAACGGCTAAAGCTGAACATAATGTG
    AAACTAATCAAAAATACTAATGTAGCACCATACAATGGTGTCGTTTCGATAGGATCTGGA
    ACAGGTTTCATTGTCGGTAAAAATACAATTGTTACCAACAAGCATGTCGTTGCAGGTATG
    GAAATTGGTGCACATATTATAGCGCATCCCAATGGTGAATATAATAATGGCGGATTTTAT
    AAAGTTAAAAAAATTGTCCGTTATTCAGGTCAAGAAGATATTGCCATTCTACATGTGGAA
    GATAAAGCTGTTCATCCAAAAAACAGGAATTTTAAAGATTACACAGGCATTTTAAAAATA
    GCATCAGAAGCTAAAGAAAATGAACGCATTTCAATTGTTGGCTATCCAGAACCATATATA
    AATAAATTTCAAATGTATGAGTCAACAGGAAAAGTGCTGTCAGTTAAAGGCAACATGATT
    ATTACTGATGCTTTCGTAGAACCAGGCAACTCAGGTTCAGCTGTATTTAACAGTAAATAC
    GAAGTTGTAGGTGTTCACTTTGGTGGAAACGGCCCTGGAAATAAAAGTACAAAAGGATAT
    GGTGTTTATTTCTCTCCTGAAATTAAGAAATTCATTGCAGATAACACAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    717

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01936
  • symbol: SAOUHSC_01936
  • description: serine protease SplE
  • length: 238
  • theoretical pI: 9.81932
  • theoretical MW: 25679.1
  • GRAVY: -0.195378

Function[edit source | edit]

  • reaction:
    EC 3.4.21.19?  ExPASy
    Glutamyl endopeptidasePreferential cleavage: Glu-|-Xaa, Asp-|-Xaa
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidespeptidase Do (TIGR02037; EC 3.4.21.-; HMM-score: 35)
    Genetic information processingProtein fateProtein folding and stabilizationpeptidase Do (TIGR02037; EC 3.4.21.-; HMM-score: 35)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesperiplasmic serine peptidase DegS (TIGR02038; EC 3.4.21.-; HMM-score: 24.8)
    Signal transductionRegulatory functionsProtein interactionsperiplasmic serine peptidase DegS (TIGR02038; EC 3.4.21.-; HMM-score: 24.8)
  • TheSEED:  
    serine protease 
  • PFAM:
    Peptidase_PA (CL0124) Trypsin; Trypsin (PF00089; HMM-score: 71.6)
    Trypsin_2; Trypsin-like peptidase domain (PF13365; HMM-score: 70.6)
    Peptidase_S46; Peptidase S46 (PF10459; HMM-score: 24.6)
    Peptidase_S7; Peptidase S7, Flavivirus NS3 serine protease (PF00949; HMM-score: 24.6)
    Peptidase_S32; Equine arteritis virus serine endopeptidase S32 (PF05579; HMM-score: 18.5)
    DUF31; Putative peptidase (DUF31) (PF01732; HMM-score: 15.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 37 aa
    • Ymax: 0.561
    • Ymax_pos: 37
    • Cmax: 0.536
    • Cmax_pos: 37
    • Smax: 0.864
    • Smax_pos: 11
    • Smean: 0.706
    • D: 0.617
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKNIIIKSIAALTILTSVTGVGTTVVEGIQQTAKAEHNVKLIKNTNVAPYNGVVSIGSGTGFIVGKNTIVTNKHVVAGMEIGAHIIAHPNGEYNNGGFYKVKKIVRYSGQEDIAILHVEDKAVHPKNRNFKDYTGILKIASEAKENERISIVGYPEPYINKFQMYESTGKVLSVKGNMIITDAFVEPGNSGSAVFNSKYEVVGVHFGGNGPGNKSTKGYGVYFSPEIKKFIADNTDK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]