From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01980
  • pan locus tag?: SAUPAN004781000
  • symbol: SAOUHSC_01980
  • pan gene symbol?: airR
  • synonym:
  • product: DNA-binding response regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01980
  • symbol: SAOUHSC_01980
  • product: DNA-binding response regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1884700..1885323
  • length: 624
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAACAAAGTAATATTAGTAGATGACCATTATATTGTGCGACAAGGATTGCGATTTTTA
    TTATCCACGATTGAAAACATAGAAGTTTTACAAGACTTTGCAGATGGAGAAACATTTTTA
    GAATATTTAAAAGAGCATGAGCACCCTGATATTGTGCTATTAGATTTAGTGATGCCTGGC
    ATGAATGGTATTGAAATTACGGAATATATTAAGGCACATTATCCGGATATTAAAGTTTTG
    GTATTAACAAGTTATGTTGATGATGAACATGTAATTTCAGCAATCAATAAAGGTGCTGAT
    GGTTATGAAATGAAAGACGTTGAGCCTCAGCAATTAATTGAAACTATTAGACGAGTTATG
    AACGGTGAAAAAATGATACATCCTAAGGCACAAGATGTATTCGAAACAGTTAGCCAAAAA
    CCACACTACACGAATAAGTTGTCAAAGAGAGAAATTGAAGTGTTACGTGAAATGGTTAAA
    GGTAAAACAAATAAAGAGATTGCAGAAACTTTATTTGTATCTGAAAAAACAATTAAAACA
    CATGTCAGTCATATATTTAGTAAATTACAAGTTAGCGATCGTACACAAGCAGCAATTTAT
    GCAATGGAAAATAAGTTGATTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01980
  • symbol: SAOUHSC_01980
  • description: DNA-binding response regulator
  • length: 207
  • theoretical pI: 5.57567
  • theoretical MW: 23895.4
  • GRAVY: -0.27971

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    transcriptional regulator EpsA (TIGR03020; HMM-score: 58.4)
    Cellular processesCellular processesSporulation and germinationsporulation transcription factor Spo0A (TIGR02875; HMM-score: 57.2)
    Signal transductionRegulatory functionsDNA interactionsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    Signal transductionSignal transductionTwo-component systemsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transductionRegulatory functionsDNA interactionsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transductionSignal transductionTwo-component systemsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 36.1)
    Signal transductionRegulatory functionsDNA interactionsPEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 35.3)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 35.1)
    Signal transductionSignal transductionTwo-component systemsTMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 33.5)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 23.9)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 21.8)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 21.8)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    probable regulatory domain (TIGR03879; HMM-score: 15.2)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 13.5)
  • TheSEED:  
    Two-component system response regulator protein 
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 96.5)
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 83)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 23.8)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 18.7)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 17.9)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.9)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.4)
    Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 14)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 13.8)
    KORA; TrfB plasmid transcriptional repressor (PF16509; HMM-score: 13.2)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.9)
    no clan definedTraC_F_IV; F pilus assembly Type-IV secretion system for plasmid transfer (PF11130; HMM-score: 12.6)
    HTH (CL0123) HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.125
    • Ymax_pos: 37
    • Cmax: 0.121
    • Cmax_pos: 37
    • Smax: 0.169
    • Smax_pos: 31
    • Smean: 0.09
    • D: 0.111
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPGMNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVMNGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]