From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02143
  • pan locus tag?: SAUPAN004958000
  • symbol: SAOUHSC_02143
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_02143
  • symbol: SAOUHSC_02143
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2016425..2017453
  • length: 1029
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGACAAATGGATATATTGGTTCTTACACTAAAAAGAATGGTAAAGGGATTTATCGTTTT
    GAATTAAACGAAAATCAGTCACGTATTGATTTATTAGAAACAGGATTTGAATTAGAAGCG
    TCTACATATTTGGTGCGTAATAATGAAGTTTTATATGGAATCAACAAAGAAGGAGAACAA
    TGCGGTGTTGCAAGTTTGAAAATTGATGACAATGGTGAATTGCATTTATTAAATAAATGT
    TTGTCTTCAAAAGCTGGTACAGGTTGTTATGTATCGATTTCAGAAGATAAACGATATTTA
    TTTGAAGCGGTATATGGTGCTGGCATCATACGTATGTATGAATTAAATACGCACACAGGT
    GAAATTATACGTCTAATTCAAGAACTTGCACATGATTTTCCAACAGGTACACATGAAAGA
    CAAGATCATCCACACGCACATTATATTAATCAAACTCCAGATGGTAAGTACGTTGCAGTA
    ACAGATTTAGGTGCTGATCGTATCGTTACTTATAAATTTGATGACAACGGGTTTGAATTT
    TATAAAGAATCTTTATTTAAAGATAGTGATGGGACAAGACATATTGAATTTCATGATAAT
    GGAAAATTTGCTTATGTCGTACACGAATTATCAAATACTGTGAGTGTTGCAGAATATAAT
    GACGGTAAATTTGAAGAGCTCGAGCGTCATTTAACAATTCCTGAAAACTTTGATGGAGAT
    ACTAAACTTGCAGCAGTGCGTTTATCTCATGATCAACAATTCTTATATGTATCTAATAGA
    GGGCATGATAGCATTGCAATTTTTAAAGTTCTTGATAATGGTCAACACTTAGAACTAGTA
    ACAATTACTGAAAGTGGTGGTCAATTCCCAAGAGATTTTAATATTGCCTCATCAGATGAC
    CTTTTAGTTTGTGCTCATGAGCAAGGAGATTCAGTTGTAACTGTTTTCGAAAGAAATAAA
    GAAACAGGTAAAATTACGCTATGTGATAACACTCGTGTAGCATCTGAAGGTGTATGTGTC
    ATATTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1029

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_02143
  • symbol: SAOUHSC_02143
  • description: hypothetical protein
  • length: 342
  • theoretical pI: 4.83508
  • theoretical MW: 38546.5
  • GRAVY: -0.460234

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    PQQ-dependent catabolism-associated beta-propeller protein (TIGR03866; HMM-score: 25.5)
    40-residue YVTN family beta-propeller repeat (TIGR02276; HMM-score: 14.4)
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismPentose phosphate pathway 6-phosphogluconolactonase (EC 3.1.1.31) 
    One-carbon MetabolismFormaldehyde assimilation: Ribulose monophosphate pathway 6-phosphogluconolactonase (EC 3.1.1.31) 
  • PFAM:
    Beta_propeller (CL0186) Lactonase; Lactonase, 7-bladed beta-propeller (PF10282; HMM-score: 356)
    SBP56; 56kDa selenium binding protein (SBP56) (PF05694; HMM-score: 17.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 11
    • Cmax: 0.109
    • Cmax_pos: 54
    • Smax: 0.182
    • Smax_pos: 1
    • Smean: 0.124
    • D: 0.119
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNGYIGSYTKKNGKGIYRFELNENQSRIDLLETGFELEASTYLVRNNEVLYGINKEGEQCGVASLKIDDNGELHLLNKCLSSKAGTGCYVSISEDKRYLFEAVYGAGIIRMYELNTHTGEIIRLIQELAHDFPTGTHERQDHPHAHYINQTPDGKYVAVTDLGADRIVTYKFDDNGFEFYKESLFKDSDGTRHIEFHDNGKFAYVVHELSNTVSVAEYNDGKFEELERHLTIPENFDGDTKLAAVRLSHDQQFLYVSNRGHDSIAIFKVLDNGQHLELVTITESGGQFPRDFNIASSDDLLVCAHEQGDSVVTVFERNKETGKITLCDNTRVASEGVCVIF

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAOUHSC_02143 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]