From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02630
  • pan locus tag?: SAUPAN005853000
  • symbol: SAOUHSC_02630
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_02630
  • symbol: SAOUHSC_02630
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2418795..2419442
  • length: 648
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAAGATGATATTAATTAATGTCATTACGGTTGTTGTACTGTTAGCAATTGGGATT
    GCTGGCTTTTATTTTTGGAATAAAACAACAAGCTATGTAACAACTGATAATGCAAAAGTA
    AATGGCGATCAAATTAAAATAGCAAGTCCTGCATCTGGACAAATTAAATCACTTAATGTT
    AAACAAGGTGACAAACTCGATAAAGGTGACAAAGTAGCAATTGTTACTGTACAAGGTCAA
    GATGGCGAAACGAAAGATATGGATCTTAAAATGCCTCAAAAAGGTACAATTGCCAAATTA
    GATGGTATGGAAGGTTCAATGGTGCAAGCTGGTAACCCAATCGCTTATGCATACAATTTA
    GATGATTTATATGTAACAGCAAATATTGACGAAAAAGATATTAAAGATGTTGAAGTAGGT
    AAAGATGTTGATGTGACTATTGACGGTCAAAAAGCTTCTATTAAAGGTAAAGTTGATAGT
    ATTGGAAAAGCAACTGCTGCAAGCTTTTCATTAATGCCATCATCAAATAGTGATGGTAAC
    TACACTAAAGTTTCTCAAGTAATACCTGTTAAAATCACTCTAGAATCAGAACCGTCTAAA
    CAAGTTGTTCCTGGAATGAACGCTGAAGTAAAAATCCATAAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    648

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_02630
  • symbol: SAOUHSC_02630
  • description: hypothetical protein
  • length: 215
  • theoretical pI: 7.49286
  • theoretical MW: 23024.3
  • GRAVY: -0.206977

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsOtherefflux pump membrane protein (TIGR00998; HMM-score: 126.2)
    MetabolismTransport and binding proteinsUnknown substrateefflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 45.5)
    ABC exporter membrane fusion protein, DevB family (TIGR02971; HMM-score: 44.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 39.3)
    MetabolismTransport and binding proteinsOthermembrane fusion protein cluster 2 protein (TIGR00999; HMM-score: 31.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 24.2)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 24.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 24.1)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesispyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 17.8)
    MetabolismEnergy metabolismPyruvate dehydrogenasedihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 17.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsoxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 14.6)
    MetabolismEnergy metabolismOtheroxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 14.6)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 14)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsMultidrug Resistance, 2-protein version Found in Gram-positive bacteria Multidrug resistance protein [function not yet clear] 
  • PFAM:
    Hybrid (CL0105) HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 61.3)
    HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 54.6)
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 37.5)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 36.5)
    HlyD; HlyD membrane-fusion protein of T1SS (PF00529; HMM-score: 16.7)
    DUF2118; Uncharacterized protein conserved in archaea (DUF2118) (PF09891; HMM-score: 15.3)
    no clan definedPASTA; PASTA domain (PF03793; HMM-score: 14.1)
    Hybrid (CL0105) Peptidase_M23; Peptidase family M23 (PF01551; HMM-score: 13.1)
    LysM (CL0187) OapA; Opacity-associated protein A LysM-like domain (PF04225; HMM-score: 11.6)
    DRMIP-like (CL0538) DUF4448; Protein of unknown function (DUF4448) (PF14610; HMM-score: 9.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.263
    • Ymax_pos: 11
    • Cmax: 0.221
    • Cmax_pos: 34
    • Smax: 0.766
    • Smax_pos: 5
    • Smean: 0.713
    • D: 0.439
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNVKQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNLDDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGNYTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]