From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02635
  • pan locus tag?: SAUPAN005861000
  • symbol: SAOUHSC_02635
  • pan gene symbol?: tcaA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_02635
  • symbol: SAOUHSC_02635
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2421820..2423202
  • length: 1383
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    ATGAAATCTTGCCCGAAGTGCGGACAACAAGCACAAGATGATGTACAGATATGTACACAA
    TGTGGACATAAATTTGATAGTCGTCAAGCATTATATAGAAAGTCAACCGATGAAGATATA
    CAAACTAATAACATCAAGATGAGAAAAATGGTGCCTTGGGCAATTGGTTTTTTCATTTTA
    ATCTTAATTATTATATTGTTCTTTTTACTAAGAAACTTCAATTCACCTGAAGCGCAAACT
    AAAATATTAGTGAATGCGATTGAGAATAATGATAAACAAAAAGTAGCAACATTATTAAGT
    ACTAAAGATAATAAAGTAGATTCTGAAGAAGCAAAAGTATACATTAACTATATCAAAGAT
    GAAGTTGGGCTTAAGCAATTTGTCAGCGACCTTAAAAATACGGTACATAAATTGAATAAG
    AGTAAGACCAGCGTAGCTTCTTATATTCAAACCAGATCTGGTCAAAATATATTACGTGTA
    AGTAAAAATGGCACACGTTATATCTTTTTCGATAATATGAGCTTTACTGCACCTACCAAG
    CAACCAATTGTTAAACCGAAAGAAAAAACAAAATATGAGTTTAAATCTGGTGGTAAGAAA
    AAGATGGTTATAGCTGAAGCAAATAAAGTGACGCCAATAGGTAATTTTATACCGGGGACA
    TATAGAATTCCAGCTATGAAATCAACTGAGAACGGTGATTTTGCAGGCCATTTAAAATTT
    GATTTTAGACAAAGTAATTCTGAAACGGTAGATGTTACTGAAGATTTTGAAGAAGCAAAT
    ATATCTGTAACTTTAAAAGGCGATACAAAATTAAATGATAGTTCTAAAAAAGTAACTATA
    AATGACCATGAAATGGCATTTTCAAGTTCCAAAACGTATGGTCCATATCCACAAAATAAA
    GATATTACCATTTCAGCTTCAGGTAAAGCGAAAGATAAAACATTTACAACACAGACGAAG
    ACGATTAAAGCTAGCGATTTAAAATACAATACAGAGATAACTTTGAATTTTGACAGTGAA
    GATATCGAAGACTATGTTGAAAAGAAAGAAAAAGAAGAAAACAGCTTGAAGAACAAATTG
    ATAGAATTCTTTGCTGGATATTCTTTAGCGAATAATGCTGCGTTTAATCAGTCGGATTTT
    GATTTTGTATCATCATATATAAAAAAAGGATCATCTTTTTATGATGATGTAAAGAAGCGT
    GTATCTAAAGGAAGTTTAATGATGATTAGTTCACCACAAATTATAGATGCTGAAAAACAT
    GGTGATAAGATTACCGCAACCGTAAGATTAATAAATGAAAACGGTAAGCAAGTAGATAAA
    GAATATGAGCTTGAACAAGGCTCGCAAGACCGCTTGCAATTAATCAAGACATCAGAAAAA
    TAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1383

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_02635
  • symbol: SAOUHSC_02635
  • description: hypothetical protein
  • length: 460
  • theoretical pI: 9.47124
  • theoretical MW: 52113.8
  • GRAVY: -0.652826

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsputative regulatory protein, FmdB family (TIGR02605; HMM-score: 13.7)
    and 1 more
    Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 5.7)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsTeicoplanin-resistance in Staphylococcus Teicoplanin resistance associated membrane protein TcaA 
  • PFAM:
    Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 28.3)
    zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 25.3)
    and 13 more
    UPF0547; Uncharacterised protein family UPF0547 (PF10571; HMM-score: 19.3)
    DZR; Double zinc ribbon (PF12773; HMM-score: 18.5)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 15.3)
    no clan definedDUF2950; Protein of unknown function (DUF2950) (PF11453; HMM-score: 14.1)
    ClpP_crotonase (CL0127) CLP_protease; Clp protease (PF00574; HMM-score: 14)
    MBB (CL0193) OprB; Carbohydrate-selective porin, OprB family (PF04966; HMM-score: 13.8)
    no clan definedDUF1461; Protein of unknown function (DUF1461) (PF07314; HMM-score: 11.6)
    Zn_Beta_Ribbon (CL0167) zinc_ribbon_15; zinc-ribbon family (PF17032; HMM-score: 11)
    RING (CL0229) Prok-RING_1; Prokaryotic RING finger family 1 (PF14446; HMM-score: 10.9)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 10.3)
    Transporter (CL0375) Clc-like; Clc-like (PF07062; HMM-score: 10)
    Zn_Beta_Ribbon (CL0167) OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 9.3)
    no clan definedYhfH; YhfH-like protein (PF14149; HMM-score: 9.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 23
    • Cmax: 0.113
    • Cmax_pos: 12
    • Smax: 0.138
    • Smax_pos: 16
    • Smean: 0.097
    • D: 0.1
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFILILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKDEVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTKQPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKFDFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNKDITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKLIEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKHGDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

M Brandenberger, M Tschierske, P Giachino, A Wada, B Berger-Bächi
Inactivation of a novel three-cistronic operon tcaR-tcaA-tcaB increases teicoplanin resistance in Staphylococcus aureus.
Biochim. Biophys. Acta: 2000, 1523(2-3);135-9
[PubMed:11042376] [WorldCat.org] (P p)
Hideki Maki, Nadine McCallum, Markus Bischoff, Akihito Wada, Brigitte Berger-Bächi
tcaA inactivation increases glycopeptide resistance in Staphylococcus aureus.
Antimicrob. Agents Chemother.: 2004, 48(6);1953-9
[PubMed:15155184] [WorldCat.org] [DOI] (P p)
N McCallum, G Spehar, M Bischoff, B Berger-Bächi
Strain dependence of the cell wall-damage induced stimulon in Staphylococcus aureus.
Biochim. Biophys. Acta: 2006, 1760(10);1475-81
[PubMed:16891058] [WorldCat.org] [DOI] (P p)