From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_03036
  • pan locus tag?: SAUPAN006465000
  • symbol: SAOUHSC_03036
  • pan gene symbol?: vraD
  • synonym:
  • product: ABC transporter ATP-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_03036
  • symbol: SAOUHSC_03036
  • product: ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2807988..2808746
  • length: 759
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACGATATTATCAGTGCAACATGTTTCAAAAACATACGGTAAAAAGCACACATTTCAA
    GCACTTAAAGATATTAACTTTGACATACAAAAAGGCGAATTCGTTGCGATTATGGGGCCT
    TCTGGATCAGGTAAGACAACCTTATTAAATGTACTAAGTTCAATTGACCAAATTTCTAGC
    GGTAGCGTGATTGCTAACGGACAAGAGCTTAATAAACTTAATCAAAAAGCACTTGCCAAA
    TTCCGCAAAGAATCATTAGGTTTCATCTTCCAAGATTACAGTATTCTGCCGACATTAACC
    GTTAAAGAAAACATTATGTTACCTTTATCTGTTCAAAAAATGTCGAAGGCAACAATGGAA
    GAAAATTATAAAGCGATCACGACAGCATTAGGTATTTATGACCTAGGAAATAAATACCCT
    AGCGAATTATCTGGTGGTCAACAACAAAGAACTGCAGCAGCGAGAGCATTTGTTCACAAA
    CCACAAATCATATTTGCAGATGAGCCAACAGGCGCACTCGACTCGAAAAGTGCAAATGAC
    CTATTACAACGTTTGGAAGAAATGAATAAATCGTTTGATACAACTATTGTCATGGTTACA
    CATGATCCGGTTGCAGCAAGTTTTGCAGAACGTGTCATCATGCTAAAAGATGGCCAAATT
    CATACACAACTTTATCAGGAAGGACGTTCTAAACAGGCCTTTTATGAAGACATTGTACAT
    CTTCAATCAGTATTAGGTGGTGTCTCAAATGACATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    759

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_03036
  • symbol: SAOUHSC_03036
  • description: ABC transporter ATP-binding protein
  • length: 252
  • theoretical pI: 7.89757
  • theoretical MW: 27774.6
  • GRAVY: -0.209127

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 220.9)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 220.9)
    Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 218.7)
    Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 205.5)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 199.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 198.8)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 185.8)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 181.5)
    and 79 more
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 157.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 154.8)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 154.4)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 151.8)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 151.4)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 147.6)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 146.3)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 140.2)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 139.4)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 138.8)
    MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 138.8)
    MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 137.8)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 137)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 136.1)
    MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 134.8)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 134.8)
    MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 134.3)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 133.4)
    Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 132)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 132)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 131.7)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 130.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 130.6)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 121.8)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 119.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 118.8)
    MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 113.7)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.1)
    MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.1)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 111.8)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 109.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 107)
    MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 107)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 103.7)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 102.6)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 102.5)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 101.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 99.7)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 96.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 94.8)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 94.8)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 94.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 94.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 91.2)
    Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 91.2)
    MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 91.2)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 89.3)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 86.2)
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 83)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 79.8)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 77.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 75.7)
    Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 68.5)
    MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 68.5)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 67.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 66.8)
    MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 58.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 56)
    MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 56)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 55.2)
    MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 43.4)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 36.3)
    MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 33.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexonuclease SbcC (TIGR00618; HMM-score: 17.7)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.5)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 16)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 15.4)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 15.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 15)
    Genetic information processingProtein synthesisOtherGTP-binding protein Era (TIGR00436; HMM-score: 14.4)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaA regulatory inactivator Hda (TIGR03420; HMM-score: 13.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 12.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repaircheckpoint protein rad24 (TIGR00602; HMM-score: 12.5)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 12.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12)
    Genetic information processingProtein synthesisTranslation factorsribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 11.9)
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase archaeal, A subunit (TIGR01043; EC 3.6.3.14; HMM-score: 11.4)
    rad50 (TIGR00606; HMM-score: 10.5)
  • TheSEED:  
    Bacitracin Stress Response ABC transporter, ATP-binding protein 
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 111.6)
    and 32 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 27)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 26.5)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 25.1)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 23.5)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 23)
    AAA_23; AAA domain (PF13476; HMM-score: 22.7)
    AAA_25; AAA domain (PF13481; HMM-score: 19.9)
    AAA_22; AAA domain (PF13401; HMM-score: 19.8)
    AAA_30; AAA domain (PF13604; HMM-score: 19.7)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 18.5)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 18.4)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 17.9)
    AAA_18; AAA domain (PF13238; HMM-score: 17.2)
    AAA_28; AAA domain (PF13521; HMM-score: 16.6)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 16.5)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 16.3)
    NTPase_1; NTPase (PF03266; HMM-score: 16.2)
    Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 14.6)
    ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 14.5)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 14.5)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 14.4)
    AAA_19; AAA domain (PF13245; HMM-score: 13.8)
    dNK; Deoxynucleoside kinase (PF01712; HMM-score: 13.7)
    NACHT; NACHT domain (PF05729; HMM-score: 13.4)
    PhoH; PhoH-like protein (PF02562; HMM-score: 13)
    AAA_24; AAA domain (PF13479; HMM-score: 12.8)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.7)
    AAA_17; AAA domain (PF13207; HMM-score: 12.7)
    Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 12.6)
    FtsK_SpoIIIE; FtsK/SpoIIIE family (PF01580; HMM-score: 12.4)
    Septin; Septin (PF00735; HMM-score: 11.8)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.173
    • Ymax_pos: 15
    • Cmax: 0.136
    • Cmax_pos: 68
    • Smax: 0.359
    • Smax_pos: 6
    • Smean: 0.254
    • D: 0.205
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTILSVQHVSKTYGKKHTFQALKDINFDIQKGEFVAIMGPSGSGKTTLLNVLSSIDQISSGSVIANGQELNKLNQKALAKFRKESLGFIFQDYSILPTLTVKENIMLPLSVQKMSKATMEENYKAITTALGIYDLGNKYPSELSGGQQQRTAAARAFVHKPQIIFADEPTGALDSKSANDLLQRLEEMNKSFDTTIVMVTHDPVAASFAERVIMLKDGQIHTQLYQEGRSKQAFYEDIVHLQSVLGGVSNDI

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]