From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS053 [new locus tag: SA_RS09440 ]
  • pan locus tag?: SAUPAN004789000
  • symbol: SAS053
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: SAS053 [new locus tag: SA_RS09440 ]
  • symbol: SAS053
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1908043..1908195
  • length: 153
  • essential: no DEG other strains

⊟Accession numbers[edit source | edit]

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACG
    GATTTTGAAGATTTAAAAGAATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGAT
    CAAGAAAAAAATTCTGAAGAAGACAGTCAGTAA
    60
    120
    153

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: SAS053 [new locus tag: SA_RS09440 ]
  • symbol: SAS053
  • description: hypothetical protein
  • length: 50
  • theoretical pI: 3.89627
  • theoretical MW: 5936.25
  • GRAVY: -1.87

⊟Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:  
    Hypothetical protein SAV1853 
  • PFAM:
    THBO-biosyn (CL0334) PTPS; 6-pyruvoyl tetrahydropterin synthase (PF01242; HMM-score: 13.1)

⊟Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

⊟Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.113
    • Ymax_pos: 49
    • Cmax: 0.102
    • Cmax_pos: 14
    • Smax: 0.154
    • Smax_pos: 2
    • Smean: 0.102
    • D: 0.109
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit source | edit]

⊟Protein sequence[edit source | edit]

  • MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

⊟Relevant publications[edit source | edit]

Retrieved from "https://aureowiki.med.uni-greifswald.de/index.php?title=SAS053&oldid=72750"