From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000006000
  • symbol?: dnaA
  • description?: chromosomal replication initiation protein

      descriptions from strain specific annotations:

    • chromosomal replication initiation protein
    • chromosomal replication initiator protein DnaA
    • chromosome replication initiator DnaA
    • ATPase DnaA
    • DNA-directed DNA replication initiator protein
  • strand?: +
  • coordinates?: 5605..6966
  • synteny block?: BlockID0000030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0001 (dnaA)
    N315:
    SA0001 (dnaA)
    NCTC8325:
    Newman:
    NWMN_0001 (dnaA)
    USA300_FPR3757:
    04-02981:
    SA2981_0001 (dnaA)
    08BA02176:
    C248_0001 (dnaA)
    11819-97:
    MS7_0001 (dnaA)
    71193:
    ST398NM01_0001
    ECT-R 2:
    ECTR2_1 (dnaA)
    ED133:
    SAOV_0001 (dnaA)
    ED98:
    SAAV_0001 (dnaA)
    HO 5096 0412:
    SAEMRSA15_00010 (dnaA)
    JH1:
    SaurJH1_0001 (dnaA)
    JH9:
    SaurJH9_0001 (dnaA)
    JKD6008:
    SAA6008_00001 (dnaA)
    JKD6159:
    SAA6159_00001 (dnaA)
    LGA251:
    SARLGA251_00010 (dnaA)
    M013:
    M013TW_0001
    MRSA252:
    SAR0001 (dnaA)
    MSHR1132:
    SAMSHR1132_00010
    MSSA476:
    SAS0001 (dnaA)
    Mu3:
    SAHV_0001 (dnaA)
    Mu50:
    SAV0001 (dnaA)
    MW2:
    MW0001 (dnaA)
    RF122:
    SAB0001 (dnaA)
    ST398:
    SAPIG0001 (dnaA)
    T0131:
    SAT0131_00001 (asnC)
    TCH60:
    HMPREF0772_10467 (dnaA)
    TW20:
    SATW20_00010 (dnaA)
    USA300_TCH1516:
    USA300HOU_0001 (dnaA)
    VC40:
    SAVC_00005 (dnaA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEI
    N315            MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEI
    NCTC8325        MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEI
    Newman          MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEI
    USA300_FPR3757  MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEI
                    ************************************************************

    COL             IQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHN
    N315            IQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHN
    NCTC8325        IQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHN
    Newman          IQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHN
    USA300_FPR3757  IQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHN
                    ************************************************************

    COL             TFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDA
    N315            TFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDA
    NCTC8325        TFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDA
    Newman          TFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDA
    USA300_FPR3757  TFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDA
                    ************************************************************

    COL             KVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNE
    N315            KVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNE
    NCTC8325        KVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNE
    Newman          KVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNE
    USA300_FPR3757  KVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNE
                    ************************************************************

    COL             LHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLD
    N315            LHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLD
    NCTC8325        LHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLD
    Newman          LHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLD
    USA300_FPR3757  LHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLD
                    ************************************************************

    COL             IPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKIT
    N315            IPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKIT
    NCTC8325        IPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKIT
    Newman          IPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKIT
    USA300_FPR3757  IPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKIT
                    ************************************************************

    COL             IQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHT
    N315            IQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHT
    NCTC8325        IQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHT
    Newman          IQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHT
    USA300_FPR3757  IQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHT
                    ************************************************************

    COL             TVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
    N315            TVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
    NCTC8325        TVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
    Newman          TVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
    USA300_FPR3757  TVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
                    *********************************