From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000010000
  • symbol?: recF
  • description?: recombination protein F

      descriptions from strain specific annotations:

    • recombination protein F
    • DNA replication and repair protein RecF
    • DNA repair and genetic recombination protein
    • recF protein
    • DNA recombination and repair protein RecF
    • DNA replication and repair RecF family protein
  • strand?: +
  • coordinates?: 9757..10869
  • synteny block?: BlockID0000070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0004 (recF)
    N315:
    SA0004 (recF)
    NCTC8325:
    Newman:
    NWMN_0003 (recF)
    USA300_FPR3757:
    04-02981:
    SA2981_0004 (recF)
    08BA02176:
    C248_0004 (recF)
    11819-97:
    MS7_0004 (recF)
    71193:
    ST398NM01_0004
    ECT-R 2:
    ECTR2_4 (recF)
    ED133:
    SAOV_0004 (recF)
    ED98:
    SAAV_0004 (recF)
    HO 5096 0412:
    SAEMRSA15_00040 (recF)
    JH1:
    SaurJH1_0004 (recF)
    JH9:
    SaurJH9_0004 (recF)
    JKD6008:
    SAA6008_00004 (recF)
    JKD6159:
    SAA6159_00004 (recF)
    LGA251:
    SARLGA251_00040 (recF)
    M013:
    M013TW_0005
    MRSA252:
    SAR0004 (recF)
    MSHR1132:
    SAMSHR1132_00040
    MSSA476:
    SAS0004 (recF)
    Mu3:
    SAHV_0004 (recF)
    Mu50:
    SAV0004 (recF)
    MW2:
    MW0004 (recF)
    RF122:
    SAB0004 (recF)
    ST398:
    SAPIG0004
    T0131:
    SAT0131_00004
    TCH60:
    HMPREF0772_10464 (recF)
    TW20:
    SATW20_00040 (recF)
    USA300_TCH1516:
    USA300HOU_0004 (recF)
    VC40:
    SAVC_00020 (recF)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL
    N315            MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL
    NCTC8325        MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL
    Newman          MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL
    USA300_FPR3757  MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL
                    ************************************************************

    COL             IRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPED
    N315            IRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPED
    NCTC8325        IRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPED
    Newman          IRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPED
    USA300_FPR3757  IRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPED
                    ************************************************************

    COL             LNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEV
    N315            LNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEV
    NCTC8325        LNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEV
    Newman          LNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEV
    USA300_FPR3757  LNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEV
                    ************************************************************

    COL             LNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAAR
    N315            LNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAAR
    NCTC8325        LNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAAR
    Newman          LNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAAR
    USA300_FPR3757  LNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAAR
                    ************************************************************

    COL             LEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEI
    N315            LEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEI
    NCTC8325        LEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEI
    Newman          LEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEI
    USA300_FPR3757  LEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEI
                    ************************************************************

    COL             ELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKL
    N315            ELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKL
    NCTC8325        ELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKL
    Newman          ELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKL
    USA300_FPR3757  ELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNPKL
                    *********************************************************.**

    COL             YRINQGEIIK
    N315            YRINQGEIIK
    NCTC8325        YRINQGEIIK
    Newman          YRINQGEIIK
    USA300_FPR3757  YRINQGEIIK
                    **********