From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000013000
  • symbol?: nnrD
  • description?: YjeF protein, C-terminal domain protein

      descriptions from strain specific annotations:

    • YjeF protein, C-terminal domain protein
    • carbohydrate kinase family protein
    • yjeF-related protein
    • putative YjeF homolog, C-terminus
    • sugar kinase
  • strand?: -
  • coordinates?: 15608..16309
  • synteny block?: BlockID0000100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0007 (yjeF)
    08BA02176:
    C248_0007
    11819-97:
    MS7_0007
    71193:
    ST398NM01_0007
    ECT-R 2:
    ECTR2_7
    ED133:
    SAOV_0007
    ED98:
    SAAV_0007
    HO 5096 0412:
    SAEMRSA15_00070
    JH1:
    SaurJH1_0007
    JH9:
    SaurJH9_0007
    JKD6008:
    SAA6008_00007
    JKD6159:
    SAA6159_00007
    LGA251:
    SARLGA251_00070
    M013:
    M013TW_0008
    MRSA252:
    SAR0007
    MSHR1132:
    SAMSHR1132_00070
    MSSA476:
    SAS0007
    Mu3:
    SAHV_0007
    Mu50:
    SAV0007
    MW2:
    MW0007
    RF122:
    SAB0007c
    ST398:
    SAPIG0007
    T0131:
    SAT0131_00007 (dnaA)
    TCH60:
    HMPREF0772_10461
    TW20:
    SATW20_00070
    USA300_TCH1516:
    USA300HOU_0007
    VC40:
    SAVC_00035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------------------------------------MLAARACVFSGSGLITV
    N315            MGGYITMETLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITV
    NCTC8325        -------------------------------------------MLAARACVFSGSGLITV
    Newman          MGGYITMETLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITV
    USA300_FPR3757  MGGYITMETLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITV
                                                               *****************

    COL             ATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQN
    N315            ATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQN
    NCTC8325        ATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQN
    Newman          ATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQN
    USA300_FPR3757  ATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQN
                    ************************************************************

    COL             IQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDR
    N315            IQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDR
    NCTC8325        IQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDR
    Newman          IQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDR
    USA300_FPR3757  IQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDR
                    ************************************************************

    COL             LGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSA
    N315            LGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSA
    NCTC8325        LGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSA
    Newman          LGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSA
    USA300_FPR3757  LGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSA
                    ************************************************************

    COL             TYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
    N315            TYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
    NCTC8325        TYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
    Newman          TYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
    USA300_FPR3757  TYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
                    ************************************