From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000018000
  • symbol?:
  • description?: azlC family protein

      descriptions from strain specific annotations:

    • azlC family protein
    • Branched-chain amino acid permease
    • amino acid transporter
    • LIV-E family amino acid exporter
  • strand?: +
  • coordinates?: 20647..21363
  • synteny block?: BlockID0000150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0010
    08BA02176:
    C248_0010
    11819-97:
    MS7_0010
    71193:
    ST398NM01_0010
    ECT-R 2:
    ECTR2_10
    ED133:
    SAOV_0010
    ED98:
    SAAV_0011
    HO 5096 0412:
    SAEMRSA15_00100
    JH1:
    SaurJH1_0010
    JH9:
    SaurJH9_0010
    JKD6008:
    SAA6008_00010 (azlC)
    JKD6159:
    SAA6159_00010 (azlC)
    LGA251:
    SARLGA251_00100
    M013:
    M013TW_0011
    MRSA252:
    SAR0010
    MSHR1132:
    SAMSHR1132_00100
    MSSA476:
    SAS0010
    Mu3:
    SAHV_0010
    Mu50:
    SAV0010
    MW2:
    MW0010
    RF122:
    SAB0010
    ST398:
    SAPIG0010
    T0131:
    SAT0131_00011
    TCH60:
    HMPREF0772_10458 (azlC)
    TW20:
    SATW20_00100
    USA300_TCH1516:
    USA300HOU_0010
    VC40:
    SAVC_00050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTHLSFRQGVQECILTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCA
    N315            MATHLSFRQGVQECIPTLLGYAGVGISFGIVASSQNFSILEIILLCLVIYAGAAQFIMCA
    NCTC8325        MTTHLSFRQGVQECIPTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCA
    Newman          MTTHLSFRQGVQECILTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCA
    USA300_FPR3757  MTTHLSFRQGVQECIPTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCA
                    *:************* **************************:*****************

    COL             LFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPY
    N315            LFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPY
    NCTC8325        LFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPY
    Newman          LFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPY
    USA300_FPR3757  LFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPY
                    ************************************************************

    COL             LKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQF
    N315            LKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQF
    NCTC8325        LKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQF
    Newman          LKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQF
    USA300_FPR3757  LKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQF
                    ************************************************************

    COL             ESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
    N315            ESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMER
    NCTC8325        ESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
    Newman          ESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
    USA300_FPR3757  ESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
                    **************************************************: