From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000019000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • branched-chain amino acid transport family protein
    • branched-chain amino acid transport protein (AzlD) family protein
    • Branched-chain amino acid transport protein, AzlD
    • LIV-E family branched chain amino acid exporter AzlD
    • transmembrane protein
  • strand?: +
  • coordinates?: 21360..21689
  • synteny block?: BlockID0000160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0011
    08BA02176:
    C248_0011
    11819-97:
    MS7_0011
    71193:
    ST398NM01_0011
    ECT-R 2:
    ECTR2_11
    ED133:
    SAOV_0011
    ED98:
    SAAV_0012
    HO 5096 0412:
    SAEMRSA15_00110
    JH1:
    SaurJH1_0011
    JH9:
    SaurJH9_0011
    JKD6008:
    SAA6008_00011 (azlD)
    JKD6159:
    SAA6159_00011 (azlD)
    LGA251:
    SARLGA251_00110
    M013:
    M013TW_0012
    MRSA252:
    SAR0011
    MSHR1132:
    SAMSHR1132_00110
    MSSA476:
    SAS0011
    Mu3:
    SAHV_0011
    Mu50:
    SAV0011
    MW2:
    MW0011
    RF122:
    SAB0011
    ST398:
    SAPIG0011
    T0131:
    SAT0131_00013 (aroA)
    TCH60:
    HMPREF0772_10457 (azlD)
    TW20:
    SATW20_00110
    USA300_TCH1516:
    USA300HOU_0011
    VC40:
    SAVC_00055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQ
    N315            MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQ
    NCTC8325        MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQ
    Newman          MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQ
    USA300_FPR3757  MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQ
                    ************************************************************

    COL             QTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
    N315            QTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMATLRFFF
    NCTC8325        QTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
    Newman          QTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
    USA300_FPR3757  QTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
                    *******************************************:*****