From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000021000
  • symbol?: metX
  • description?: homoserine-o-acetyltransferase

      descriptions from strain specific annotations:

    • homoserine-o-acetyltransferase
    • alpha/beta hydrolase
    • homoserine O-acetyltransferase, putative
    • alpha/beta hydrolase fold family protein
    • putative homoserine O-acetyltransferase
    • putative hydrolase
  • strand?: +
  • coordinates?: 22036..23025
  • synteny block?: BlockID0000180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0012
    08BA02176:
    C248_0012
    11819-97:
    MS7_0012
    71193:
    ST398NM01_0012
    ECT-R 2:
    ECTR2_12
    ED133:
    SAOV_0012
    ED98:
    SAAV_0014
    HO 5096 0412:
    SAEMRSA15_00120
    JH1:
    SaurJH1_0012
    JH9:
    SaurJH9_0012
    JKD6008:
    SAA6008_00012 (metX)
    JKD6159:
    SAA6159_00012 (metX)
    LGA251:
    SARLGA251_00120
    M013:
    M013TW_0013
    MRSA252:
    SAR0012
    MSHR1132:
    SAMSHR1132_00120
    MSSA476:
    SAS0012
    Mu3:
    SAHV_0012
    Mu50:
    SAV0012
    MW2:
    MW0012
    RF122:
    SAB0012
    ST398:
    SAPIG0012
    T0131:
    SAT0131_00014 (aroB)
    TCH60:
    HMPREF0772_10456 (metX)
    TW20:
    SATW20_00120
    USA300_TCH1516:
    USA300HOU_0012 (metX)
    VC40:
    SAVC_00060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKEERTMTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTY
    N315            MFKEERTMTNYTVDTLNLGKFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTY
    NCTC8325        -------MTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTY
    Newman          -------MTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTY
    USA300_FPR3757  -------MTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTY
                           ************:****************************************

    COL             GTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANE
    N315            GTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANE
    NCTC8325        GTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANE
    Newman          GTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANE
    USA300_FPR3757  GTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANE
                    ************************************************************

    COL             RGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQ
    N315            RGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQ
    NCTC8325        RGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQ
    Newman          RGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQ
    USA300_FPR3757  RGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQ
                    ************************************************************

    COL             AIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLL
    N315            AIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLL
    NCTC8325        AIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLL
    Newman          AIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLL
    USA300_FPR3757  AIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLL
                    ************************************************************

    COL             DVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDN
    N315            DVLDSHNIDRGRTDVTHIFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDN
    NCTC8325        DVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDN
    Newman          DVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDN
    USA300_FPR3757  DVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDN
                    *****************:******************************************

    COL             VGHDGFLLNFSTWAPNLYHFLNLKHFKRK
    N315            VGHDGFLLNFSTWAPNLYHFLNLKHFKRK
    NCTC8325        VGHDGFLLNFSTWAPNLYHFLNLKHFKRK
    Newman          VGHDGFLLNFSTWAPNLYHFLNLKHFKRK
    USA300_FPR3757  VGHDGFLLNFSTWAPNLYHFLNLKHFKRK
                    *****************************