From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan000035000
  • symbol?: walI
  • description?: yycH family protein

      descriptions from strain specific annotations:

    • yycH family protein
    • regulatory protein YycI
    • yycI protein
    • YycI like protein
  • strand?: +
  • coordinates?: 35231..36019
  • synteny block?: BlockID0000320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0022 (yycI)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0021
    08BA02176:
    C248_0024 (yycI)
    11819-97:
    MS7_0023
    71193:
    ST398NM01_0023
    ECT-R 2:
    ECTR2_23
    ED133:
    SAOV_0023 (yycI)
    ED98:
    SAAV_0025 (yycI)
    HO 5096 0412:
    SAEMRSA15_00210 (yycI)
    JH1:
    SaurJH1_0021
    JH9:
    SaurJH9_0021
    JKD6008:
    SAA6008_00021 (yycI)
    JKD6159:
    SAA6159_00021 (yycI)
    LGA251:
    SARLGA251_00210 (yycI)
    M013:
    M013TW_0024
    MRSA252:
    SAR0021 (yycI)
    MSHR1132:
    SAMSHR1132_00220
    MSSA476:
    SAS0021
    Mu3:
    SAHV_0021
    Mu50:
    SAV0021
    MW2:
    MW0021
    RF122:
    SAB0021 (yycI)
    ST398:
    SAPIG0023
    T0131:
    SAT0131_00023 (engA)
    TCH60:
    HMPREF0772_10447 (yycI)
    TW20:
    SATW20_00210 (yycI)
    USA300_TCH1516:
    USA300HOU_0021 (yycI)
    VC40:
    SAVC_00105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKS
    N315            MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPASILNKS
    NCTC8325        MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKS
    Newman          MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKS
    USA300_FPR3757  MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKS
                    *****************************************************:******

    COL             VKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKR
    N315            VKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKR
    NCTC8325        VKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKR
    Newman          VKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKR
    USA300_FPR3757  VKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKR
                    ************************************************************

    COL             VFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTD
    N315            VFKGSEYQLSEINSGSVKYEQTYDNFPILNNSKAMLNFNIEDNKAASYKQSMMDDIKPTD
    NCTC8325        VFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTD
    Newman          VFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTD
    USA300_FPR3757  VFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTD
                    ****:*******.*.*********:********************:**************

    COL             GADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHD
    N315            GADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHD
    NCTC8325        GADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHD
    Newman          GADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHD
    USA300_FPR3757  GADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHD
                    ************************************************************

    COL             GKDKTNTYYVEATNNNPKIINH
    N315            GKDKTNTYYVEATNNNPKIINH
    NCTC8325        GKDKTNTYYVEATNNNPKIINH
    Newman          GKDKTNTYYVEATNNNPKIINH
    USA300_FPR3757  GKDKTNTYYVEATNNNPKIINH
                    **********************