From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000054000
  • symbol?: tnp
  • description?: transposase for IS-like element

      descriptions from strain specific annotations:

    • transposase for IS-like element
    • integrase catalytic subunit
    • integrase catalytic region
    • Transposase for insertion sequence-like element IS431mec
    • IS1216 transposase
    • transposase for IS431mec
    • transposase IS66 family protein
    • IS431mec transposase
    • putative transposase
    • IS431mec, transposase
    • IS431 transposase
    • transposase for insertion sequence element IS431
  • strand?: +
  • coordinates?: 61047..61721
  • synteny block?: BlockID0000470
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0027
    08BA02176:
    C248_0038 (tnp2)
    11819-97:
    MS7_0029
    71193:
    ECT-R 2:
    ECTR2_30
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00270
    JH1:
    SaurJH1_0026
    JH9:
    SaurJH9_0026
    JKD6008:
    SAA6008_00027
    JKD6159:
    SAA6159_00027
    LGA251:
    M013:
    M013TW_0041
    MRSA252:
    SAR0027
    MSHR1132:
    SAMSHR1132_00280
    MSSA476:
    Mu3:
    SAHV_0027 (tnp)
    Mu50:
    SAV0027 (tnp)
    MW2:
    MW0027
    RF122:
    ST398:
    SAPIG0038
    T0131:
    SAT0131_00030
    TCH60:
    HMPREF0772_10440 (tnp)
    TW20:
    SATW20_00690
    USA300_TCH1516:
    USA300HOU_0026
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQ
    N315            MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQ
    USA300_FPR3757  MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQ
                    ************************************************************

    COL             IWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRL
    N315            IWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRL
    USA300_FPR3757  IWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRL
                    ************************************************************

    COL             IKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRY
    N315            IKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRY
    USA300_FPR3757  IKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRY
                    ************************************************************

    COL             QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
    N315            QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
    USA300_FPR3757  QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
                    ********************************************