From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000101000
  • symbol?: mecA
  • description?: penicillin binding protein 2 prime

      descriptions from strain specific annotations:

    • penicillin binding protein 2 prime
    • penicillin-binding protein 2'
    • peptidoglycan glycosyltransferase
    • Penicillin-binding protein PBP2a, methicillin resistance determinant MecA, transpeptidase
    • penicillin-binding protein 3 (pbp 3) (pspb20)
    • penicillin-binding protein PBP2a, methicillin resistance determinant MecA
    • beta-lactam-inducible penicillin-binding protein
  • strand?: -
  • coordinates?: 118573..120700
  • synteny block?: BlockID0000790
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0033 (mecA)
    N315:
    SA0038 (mecA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0039 (mecA)
    08BA02176:
    C248_0036 (mecA)
    11819-97:
    MS7_0033 (mecA)
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00310 (mecA)
    JH1:
    SaurJH1_0029
    JH9:
    SaurJH9_0029
    JKD6008:
    SAA6008_00039 (mecA)
    JKD6159:
    SAA6159_00031 (mecA)
    LGA251:
    SARLGA251_00260 (mecA)
    M013:
    M013TW_0045
    MRSA252:
    SAR0039 (mecA)
    MSHR1132:
    SAMSHR1132_00320
    MSSA476:
    Mu3:
    SAHV_0040 (mecA)
    Mu50:
    SAV0041 (mecA)
    MW2:
    MW0031 (mecA)
    RF122:
    ST398:
    SAPIG0042
    T0131:
    SAT0131_00034 (recF)
    TCH60:
    HMPREF0772_10435 (mecA)
    TW20:
    SATW20_00740 (mecA)
    USA300_TCH1516:
    USA300HOU_0031 (mecA)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEV
    N315            MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEV
    USA300_FPR3757  MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEV
                    ************************************************************

    COL             EMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKED
    N315            EMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKED
    USA300_FPR3757  EMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKED
                    ************************************************************

    COL             GMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSK
    N315            GMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSK
    USA300_FPR3757  GMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSK
                    ************************************************************

    COL             KDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETES
    N315            KDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETES
    USA300_FPR3757  KDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETES
                    ************************************************************

    COL             RNYPLEKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVT
    N315            RNYPLGKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVT
    USA300_FPR3757  RNYPLGKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVT
                    ***** ******************************************************

    COL             IVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLAL
    N315            IVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLAL
    USA300_FPR3757  IVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLAL
                    ************************************************************

    COL             VSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLD
    N315            VSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLD
    USA300_FPR3757  VSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLD
                    ************************************************************

    COL             DKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFE
    N315            DKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFE
    USA300_FPR3757  DKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFE
                    ************************************************************

    COL             KGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALEN
    N315            KGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALEN
    USA300_FPR3757  KGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALEN
                    ************************************************************

    COL             NGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGT
    N315            NGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGT
    USA300_FPR3757  NGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGT
                    ************************************************************

    COL             AELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENG
    N315            AELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENG
    USA300_FPR3757  AELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENG
                    ************************************************************

    COL             NKKYDIDE
    N315            NKKYDIDE
    USA300_FPR3757  NKKYDIDE
                    ********