From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000148000
  • symbol?:
  • description?: membrane spanning protein
  • strand?: +
  • coordinates?: 192394..1034490
  • synteny block?: BlockID0001180
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0092
    08BA02176:
    C248_0084
    11819-97:
    MS7_0085
    71193:
    ST398NM01_0108
    ECT-R 2:
    ECTR2_49
    ED133:
    SAOV_0044
    ED98:
    SAAV_0040
    HO 5096 0412:
    SAEMRSA15_00620
    JH1:
    SaurJH1_0082
    JH9:
    SaurJH9_0079
    JKD6008:
    SAA6008_00077
    JKD6159:
    SAA6159_00074
    LGA251:
    M013:
    MRSA252:
    SAR0102
    MSHR1132:
    SAMSHR1132_00690
    MSSA476:
    SAS0067
    Mu3:
    SAHV_0091
    Mu50:
    SAV0092
    MW2:
    MW0067
    RF122:
    ST398:
    SAPIG0108
    T0131:
    TCH60:
    HMPREF0772_10399
    TW20:
    SATW20_01110
    USA300_TCH1516:
    USA300HOU_0105
    VC40:
    SAVC_00210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MLISLVIPVFALLVIGGIIWMIIEGIVHISKKNKAIDNFFNQVNKVSETYKFATTFL
    N315            MNDMLISLVIPVFALLVIGGIIWVIIEGIVHISKKNKAIDNFLNQVNKVSETYKFATAFL
    NCTC8325        ---MLISLVIPVFALLVIGGIIWMIIEGIVHISKKNKAIDNFFNQVNKVSETYKFATTFL
    Newman          ---MLISLVIPVFALLVIGGIIWMIIEGIVHISKKNKAIDNFFNQVNKVSETYKFATTFL
    USA300_FPR3757  ---MLISLVIPVFALLVIGGIIWMIIEGIVHISKKNKAIDNFFNQVNKVSETYKFATTFL
                       ********************:******************:**************:**

    COL             FLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLPFYKQKKKKQTFKK
    N315            FLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLPLYKQKKKKQTFKK
    NCTC8325        FLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLPFYKQKKKKQTFKK
    Newman          FLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLPFYKQKKKKQTFKK
    USA300_FPR3757  FLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLPFYKQKKKKQTFKK
                    ***********************************************:************

    COL             YMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGGYAYLALAVLSTLLI
    N315            YMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGGYAYLALAVLSTLLI
    NCTC8325        YMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGGYAYLALAVLSTLLI
    Newman          YMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGGYAYLALAVLSTLLI
    USA300_FPR3757  YMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGGYAYLALAVLSTLLI
                    ************************************************************

    COL             VAKKATNKNKEIETVDNTNITER
    N315            VAKKATNKNKEIETVDNTNITER
    NCTC8325        VAKKATNKNKEIETVDNTNITER
    Newman          VAKKATNKNKEIETVDNTNITER
    USA300_FPR3757  VAKKATNKNKEIETVDNTNITER
                    ***********************