From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000486000
  • symbol?: cstB
  • description?: hydroxyacylglutathione hydrolase

      descriptions from strain specific annotations:

    • hydroxyacylglutathione hydrolase
    • metallo-beta-lactamase family protein
    • metallo-beta-lactamase superfamily protein
    • beta-lactamase domain-containing protein
    • Metal-dependent hydrolase with rhodanese-homology domain (RHOD)
  • strand?: +
  • coordinates?: 520267..522435
  • synteny block?: BlockID0002160
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0087
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_45
    ED133:
    SAOV_0039
    ED98:
    SAAV_0035
    HO 5096 0412:
    JH1:
    SaurJH1_0076
    JH9:
    SaurJH9_0074
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_00660
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0057
    Mu3:
    SAHV_0086
    Mu50:
    SAV0087
    MW2:
    MW0057
    RF122:
    SAB0031
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0093
    VC40:
    SAVC_00150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHAD
    N315            MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHAD
    NCTC8325        MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHAD
    Newman          MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHAD
    USA300_FPR3757  MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHAD
                    ************************************************************

    COL             FASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHT
    N315            FASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHT
    NCTC8325        FASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHT
    Newman          FASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHT
    USA300_FPR3757  FASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHT
                    ************************************************************

    COL             PESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQIKGSTEISAKQMYESVQ
    N315            PESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQIKGSTEISAKQMYESVQ
    NCTC8325        PESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQIKGSTEISAKQMYESVQ
    Newman          PESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQIKGSTEISAKQMYESVQ
    USA300_FPR3757  PESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQIKGSTEISAKQMYESVQ
                    ************************************************************

    COL             NIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQP
    N315            NIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQP
    NCTC8325        NIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQP
    Newman          NIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQP
    USA300_FPR3757  NIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQP
                    ************************************************************

    COL             APPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKN
    N315            APPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKN
    NCTC8325        APPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKN
    Newman          APPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKN
    USA300_FPR3757  APPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKN
                    ************************************************************

    COL             FINQIGWYLDFEKDIDLIGDKSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMT
    N315            FINQIGWYLDFEKDIDLIGDKSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMT
    NCTC8325        FINQIGWYLDFEKDIDVIGDKSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMT
    Newman          FINQIGWYLDFEKDIDLIGDKSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMT
    USA300_FPR3757  FINQIGWYLDFEKDIDLIGDKSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMT
                    ****************:*******************************************

    COL             GKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNKEDKIYVHCQSGVRSSIAVGI
    N315            GKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNKEDKIYVHCQSGVRSSIAVGI
    NCTC8325        GKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNKEDKIYVHCQSGVRSSIAVGI
    Newman          GKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNKEDKIYVHCQSGVRSSIAVGI
    USA300_FPR3757  GKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNKEDKIYVHCQSGVRSSIAVGI
                    ************************************************************

    COL             LESKGFENVVNIREGYQDFPESLK
    N315            LESKGFENVVNIREGYQDFPESLK
    NCTC8325        LESKGFENVVNIREGYQDFPESLK
    Newman          LESKGFENVVNIREGYQDFPESLK
    USA300_FPR3757  LESKGFENVVNIREGYQDFPESLK
                    ************************