From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000487000
  • symbol?: cstA
  • description?: rhodanese domain-containing protein

      descriptions from strain specific annotations:

    • rhodanese domain-containing protein
    • sirA-like family protein
  • strand?: +
  • coordinates?: 522466..523534
  • synteny block?: BlockID0002170
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0086
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_44
    ED133:
    SAOV_0038
    ED98:
    SAAV_0034
    HO 5096 0412:
    JH1:
    SaurJH1_0075
    JH9:
    SaurJH9_0073
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_00650
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0056
    Mu3:
    SAHV_0085
    Mu50:
    SAV0086
    MW2:
    MW0056
    RF122:
    SAB0030
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0092
    VC40:
    SAVC_00145

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNK
    N315            MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNK
    NCTC8325        MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNK
    Newman          MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNK
    USA300_FPR3757  MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNK
                    ************************************************************

    COL             TYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQ
    N315            TYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAY-EENDSYDTQEEYKSIEIKADRKQ
    NCTC8325        TYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQ
    Newman          TYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQ
    USA300_FPR3757  TYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQ
                    ************************************ ***********************

    COL             FNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNN
    N315            FNYRGFQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNN
    NCTC8325        FNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNN
    Newman          FNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNN
    USA300_FPR3757  FNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNN
                    *****:******************************************************

    COL             GINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
    N315            GINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
    NCTC8325        GINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
    Newman          GINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
    USA300_FPR3757  GINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
                    ************************************************************

    COL             LNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLP
    N315            LNALKKVQTVNVKKQGIAKMFDLMLPQKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLP
    NCTC8325        LNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLP
    Newman          LNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLP
    USA300_FPR3757  LNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLP
                    **************************:*********************************

    COL             TLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI
    N315            TLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI
    NCTC8325        TLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI
    Newman          TLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI
    USA300_FPR3757  TLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI
                    *******************************************************