From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000838000
  • symbol?: sqr
  • description?: NAD(P)/FAD-dependent oxidoreductase

      descriptions from strain specific annotations:

    • NAD(P)/FAD-dependent oxidoreductase
    • FAD-dependent pyridine nucleotide-disulfide oxidoreductase
    • pseudogene
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • sulfide-quinone reductase
  • strand?: +
  • coordinates?: 1088262..1089464
  • synteny block?: BlockID0004050
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0088
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_46
    ED133:
    ED98:
    SAAV_0036
    HO 5096 0412:
    JH1:
    SaurJH1_0077
    JH9:
    SaurJH9_0075
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0058
    Mu3:
    SAHV_0087
    Mu50:
    SAV0088
    MW2:
    MW0058
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0094
    VC40:
    SAVC_00155

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVS
    N315            ---MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVS
    NCTC8325        ---MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVS
    Newman          MEKMNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVS
                       *********************************************************

    COL             SLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFLVVAPGLQINWSSI
    N315            SLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFLVVAPGLQINWSSI
    NCTC8325        SLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFLVVAPGLQINWSSI
    Newman          SLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFLVVAPGLQINWSSI
                    ************************************************************

    COL             KGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIKCGGAPMKIMYLAED
    N315            KGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIKCGGAPMKIMYLAED
    NCTC8325        KGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIKCGGAPMKIMYLAED
    Newman          KGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIKCGGAPMKIMYLAED
                    ************************************************************

    COL             YFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVAT
    N315            YFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVAT
    NCTC8325        YFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVAT
    Newman          YFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVAT
                    ************************************************************

    COL             FEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALG
    N315            FEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALG
    NCTC8325        FEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALG
    Newman          FEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALG
                    ************************************************************

    COL             DASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDY
    N315            DASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDY
    NCTC8325        DASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDY
    Newman          DASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDY
                    ************************************************************

    COL             NKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI
    N315            NKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI
    NCTC8325        NKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI
    Newman          NKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI
                    ****************************************