Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000902000
  • symbol?:
  • description?: myosin-cross-reactive antigen

      descriptions from strain specific annotations:

    • myosin-cross-reactive antigen
    • 67 kDa Myosin-crossreactive antigen
    • 67 kDa Myosin-crossreactive streptococcal antigen
    • 67 kDa myosin-cross-reactive antigen like family protein
    • putative myosin-crossreactive antigen
    • antigen, 67 kDa
    • 67 kDa Myosin-crossreactive antigen-like protein
  • strand?: -
  • coordinates?: 1166681..1168456
  • synteny block?: BlockID0004400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0106
    08BA02176:
    C248_0095
    11819-97:
    MS7_0100
    71193:
    ST398NM01_0119
    ECT-R 2:
    ECTR2_62
    ED133:
    SAOV_0055
    ED98:
    SAAV_0073
    HO 5096 0412:
    SAEMRSA15_00740
    JH1:
    SaurJH1_0097
    JH9:
    SaurJH9_0093
    JKD6008:
    SAA6008_00086
    JKD6159:
    SAA6159_00091
    LGA251:
    SARLGA251_00810
    M013:
    M013TW_0095
    MRSA252:
    SAR0111
    MSHR1132:
    SAMSHR1132_00810
    MSSA476:
    SAS0082
    Mu3:
    SAHV_0105
    Mu50:
    SAV0106
    MW2:
    MW0081
    RF122:
    SAB0045c
    ST398:
    SAPIG0119
    T0131:
    SAT0131_00090
    TCH60:
    HMPREF0772_10389
    TW20:
    SATW20_01200
    USA300_TCH1516:
    USA300HOU_0117
    VC40:
    SAVC_00270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYYSYGNYEAFARPKKPENVENKSAYLIGSGLASLAAACFLIRDGQMEGSKIHILEELPK
    N315            MYYSYGNYEAFARPKKPENVENKSAYLIGSGLASLAAACFLIRDGQMEGSKIHILEELPK
    NCTC8325        MYYSYGNYEAFARPKKPENVENKSAYLIGSGLASLAAACFLIRDGQMEGSKIHILEELPK
    Newman          MYYSYGNYEAFARPKKPENVENKSAYLIGSGLASLAAACFLIRDGQMEGSKIHILEELPK
    USA300_FPR3757  MYYSYGNYEAFARPKKPENVENKSAYLIGSGLASLAAACFLIRDGQMEGSKIHILEELPK
                    ************************************************************

    COL             AGGSLDGENMPLKGYVVRGGREMENHFECLWDLFRSIPSLEIDNASVLDEFYWLNKEDPN
    N315            AGGSLDGENMPLKGYVVRGGREMENHFECLWDLFRSIPSLEIDNASVLDEFYWLNKEDPN
    NCTC8325        AGGSLDGENMPLKGYVVRGGREMENHFECLWDLFRSIPSLEIDNASVLDEFYWLNKEDPN
    Newman          AGGSLDGENMPLKGYVVRGGREMENHFECLWDLFRSIPSLEIDNASVLDEFYWLNKEDPN
    USA300_FPR3757  AGGSLDGENMPLKGYVVRGGREMENHFECLWDLFRSIPSLEIDNASVLDEFYWLNKEDPN
                    ************************************************************

    COL             YSRCRVIEKQGQRLVTDGDFTLTKTAIKEILDLCLTNEEDLDDVKITDVFSDDFFNSNFW
    N315            YSRCRVIEKQGQRLVTDGDFTLTKTAIKEILDLCLTNEEDLDDVKITDVFSDDFFNSNFW
    NCTC8325        YSRCRVIEKQGQRLVTDGDFTLTKTAIKEILDLCLTNEEDLDDVKITDVFSDDFFNSNFW
    Newman          YSRCRVIEKQGQRLVTDGDFTLTKTAIKEILDLCLTNEEDLDDVKITDVFSDDFFNSNFW
    USA300_FPR3757  YSRCRVIEKQGQRLVTDGDFTLTKTAIKEILDLCLTNEEDLDDVKITDVFSDDFFNSNFW
                    ************************************************************

    COL             IYWKTMFAFEPWHSAMEMRRYLMRFVHHISGLADFSALKFTKYNQYESLVLPMVEYLKSH
    N315            IYWKTMFAFEPWHSAMEMRRYLMRFVHHIGGLADFSALKFTKYNQYESLVLPMVEYLKSH
    NCTC8325        IYWKTMFAFEPWHSAMEMRRYLMRFVHHISGLADFSALKFTKYNQYESLVLPMVEYLKSH
    Newman          IYWKTMFAFEPWHSAMEMRRYLMRFVHHISGLADFSALKFTKYNQYESLVLPMVEYLKSH
    USA300_FPR3757  IYWKTMFAFEPWHSAMEMRRYLMRFVHHISGLADFSALKFTKYNQYESLVLPMVEYLKSH
                    *****************************.******************************

    COL             GVQFEYDVKVEDIKIDVTTSQKIAREILIDRNGNAESIKLTINDLVFVTNGSITESSTYG
    N315            GVQFEYDVKVEDIKVDVTTSQKIAREILIHRHGKAESIKLTVDDLVFVTNGSITESSTYG
    NCTC8325        GVQFEYDVKVEDIKIDVTTSQKIAREILIDRNGNAESIKLTINDLVFVTNGSITESSTYG
    Newman          GVQFEYDVKVEDIKIDVTTSQKIAREILIDRNGNAESIKLTINDLVFVTNGSITESSTYG
    USA300_FPR3757  GVQFEYDVKVEDIKIDVTTSQKIAREILIDRNGNAESIKLTINDLVFVTNGSITESSTYG
                    **************:**************.*:*:*******::*****************

    COL             DNDTPAPPTDELGGSWTLWKNLARQSPEFGNPDKFCQNIPKKSWFVSATSTTNNKEIIDT
    N315            DNDTPAPPTDELGGSWTLWKNLARQSPEFGNPDKFCQNIPKKSWFVSATSTTNNKEIIDT
    NCTC8325        DNDTPAPPTDELGGSWTLWKNLARQSPEFGNPDKFCQNIPKKSWFVSATSTTNNKEIIDT
    Newman          DNDTPAPPTDELGGSWTLWKNLARQSPEFGNPDKFCQNIPKKSWFVSATSTTNNKEIIDT
    USA300_FPR3757  DNDTPAPPTDELGGSWTLWKNLARQSPEFGNPDKFCQNIPKKSWFVSATSTTNNKEIIDT
                    ************************************************************

    COL             IESICKRDPLAGKTVTGGIITINDSAWQMSFTINRQQQFKDQPENEISTWIYALYSDVNG
    N315            IESICKRDPLAGKTVTGGIITINDSAWQMSFTINRQQQFKDQPENEISTWIYALYSDVNG
    NCTC8325        IESICKRDPLAGKTVTGGIITINDSAWQMSFTINRQQQFKDQPENEISTWIYALYSDVNG
    Newman          IESICKRDPLAGKTVTGGIITINDSAWQMSFTINRQQQFKDQPENEISTWIYALYSDVNG
    USA300_FPR3757  IESICKRDPLAGKTVTGGIITINDSAWQMSFTINRQQQFKDQPENEISTWIYALYSDVNG
                    ************************************************************

    COL             DYIKKPITECSGNEICQEWLYHLGVSTDKIEDLAKHASNTIPVYMPYITSYFMTRAIGDR
    N315            DYIKKPITECSGNEICQEWLYHLGVSTDKIEDLAKHVSNTIPVYMPYITSYFMTRAIGDR
    NCTC8325        DYIKKPITECSGNEICQEWLYHLGVSTDKIEDLAKHASNTIPVYMPYITSYFMTRAIGDR
    Newman          DYIKKPITECSGNEICQEWLYHLGVSTDKIEDLAKHASNTIPVYMPYITSYFMTRAIGDR
    USA300_FPR3757  DYIKKPITECSGNEICQEWLYHLGVSTDKIEDLAKHASNTIPVYMPYITSYFMTRAIGDR
                    ************************************.***********************

    COL             PLVVPHQSQNLAFIGNFAETERDTVFTTEYSVRTAMEAVYQLLNIDRGIPEVINSPFDLR
    N315            PLVVPHQSQNLSFIGNFAETERDTVFTTEYSVRTAMEAVYQLLNIDRGIPEVINSTFDLR
    NCTC8325        PLVVPHQSQNLAFIGNFAETERDTVFTTEYSVRTAMEAVYQLLNIDRGIPEVINSPFDLR
    Newman          PLVVPHQSQNLAFIGNFAETERDTVFTTEYSVRTAMEAVYQLLNIDRGIPEVINSPFDLR
    USA300_FPR3757  PLVVPHQSQNLAFIGNFAETERDTVFTTEYSVRTAMEAVYQLLNIDRGIPEVINSPFDLR
                    ***********:*******************************************.****

    COL             VLMDAIYELNDHQDLREITKDSKMQKLALAGFLKKIKGTYIESLLKEHKLL
    N315            VLMDAVYELNDHQDLREITKDSKMQKLALAGFLKKIKGTYIETLLKEHKLL
    NCTC8325        VLMDAIYELNDHQDLREITKDSKMQKLALAGFLKKIKGTYIESLLKEHKLL
    Newman          VLMDAIYELNDHQDLREITKDSKMQKLALAGFLKKIKGTYIESLLKEHKLL
    USA300_FPR3757  VLMDAIYELNDHQDLREITKDSKMQKLALAGFLKKIKGTYIESLLKEHKLL
                    *****:************************************:********