From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000903000
  • symbol?:
  • description?: integral membrane domain-containing protein

      descriptions from strain specific annotations:

    • integral membrane domain-containing protein
    • Permease of the drug/metabolite transporter (DMT) superfamily
    • drug/metabolite exporter family protein
    • DMT family permease
    • membrane transporter
  • strand?: -
  • coordinates?: 1168631..1169503
  • synteny block?: BlockID0004410
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0107
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_63
    ED133:
    ED98:
    SAAV_0074
    HO 5096 0412:
    JH1:
    SaurJH1_0098
    JH9:
    SaurJH9_0094
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_00820
    M013:
    M013TW_0096
    MRSA252:
    MSHR1132:
    SAMSHR1132_00830
    MSSA476:
    Mu3:
    SAHV_0106
    Mu50:
    SAV0107
    MW2:
    RF122:
    SAB0046c
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0118
    VC40:
    SAVC_00275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKLRDTTFLSYLFTIILWGSAFPMIKIALNDFSAESLSAFRLILATIILLPFVIIKKLP
    N315            MNKLRDTTFLSYLFTIILWGSAFPMIKIALNDFSAESLSAFRLILATIILLPFVIIKKLP
    NCTC8325        MNKLRDTTFLSYLFTIILWGSAFPMIKIALNDFSAESLSAFRLILATIILLPFVIIKKLP
    Newman          MNKLRDTTFLSYLFTIILWGSAFPMIKIALNDFSAESLSAFRLILATIILLPFVIIKKLP
    USA300_FPR3757  MNKLQDTTFLSYLFTIILWGSAFPMIKIALNDFSAESLSAFRLILATIILLPFVIIKKLP
                    ****:*******************************************************

    COL             TPELRDIPVIFILGFCGFVIYHTALNFGETLISAGISGILVSTTPIFSSALAYIFLKEHF
    N315            TPELRDIPVIFILGFCGFVIYHTALNFGETLISAGISGILVSTTPIFSSALAYIFLKEHF
    NCTC8325        TPELRDIPVIFILGFCGFVIYHTALNFGETLISAGISGILVSTTPIFSSALAYIFLKEHF
    Newman          TPELRDIPVIFILGFCGFVIYHTALNFGETLISAGISGILVSTTPIFSSALAYIFLKEHF
    USA300_FPR3757  TPELRDIPVIFILGFCGFVIYHTALNFGEALISAGISGILVSTTPIFSSALAYIFLKEHF
                    *****************************:******************************

    COL             SKWNWLSSLVAFIGISIISISKDDYTTINVLGVFIILLASFSESLYFTFQKKYIEKYGFI
    N315            SKWNWLSSLVAFIGISIISISKDDYTTINVLGVFIILLASFSESLYFTFQKKYIEKYGFI
    NCTC8325        SKWNWLSSLVAFIGISIISISKDDYTTINVLGVFIILLASFSESLYFTFQKKYIEKYGFI
    Newman          SKWNWLSSLVAFIGISIISISKDDYTTINVLGVFIILLASFSESLYFTFQKKYIEKYGFI
    USA300_FPR3757  SKWNWLSSLVAFIGISIISISKDDYTTINVLGVFIILLASFSESLYFTFQKKYIEKYGFI
                    ************************************************************

    COL             AFTLYTIMASSPFMLIFIPEIINDIHGATFTSIVSVLYLAIFPTIIPYVLLAYIVKSVGV
    N315            AFTLYTIMASSPFMLIFIPEIINDIHGATFTSIVSVLYLAIFPTIIPYVLLAYIVKSVGV
    NCTC8325        AFTLYTIMASSPFMLIFIPEIINDIHGATFTSIVSVLYLAIFPTIIPYVLLAYIVKSVGV
    Newman          AFTLYTIMASSPFMLIFIPEIINDIHGATFTSIVSVLYLAIFPTIIPYVLLAYIVKSVGV
    USA300_FPR3757  AFTLYTIMASSPFMLIFIPEIINDIHGATFTSIVSVLYLAIFPTIIPYVLLAYIVKSVGV
                    ************************************************************

    COL             SDATMSLYLTPIVSLLLSYLLLDELPTTLAIIGGIITLLGVSLSNFFQNT
    N315            SDATMSLYLTPIVSLLLSYLLLDELPTTLAIIGGIITLLGVSLSNFFQNT
    NCTC8325        SDATMSLYLTPIVSLLLSYLLLDELPTTLAIIGGIITLLGVSLSNFFQNT
    Newman          SDATMSLYLTPIVSLLLSYLLLDELPTTLAIIGGIITLLGVSLSNFFQNT
    USA300_FPR3757  SDATMSLYLTPIVSLLLSYLLLDELPTTLAIIGGIITLLGVSLSNFFQNT
                    **************************************************