From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000910000
  • symbol?: sarS
  • description?: accessory regulator A-like protein

      descriptions from strain specific annotations:

    • accessory regulator A-like protein
    • accessory regulator S
    • regulatory protein
    • accessory regulator-like protein
    • SarA family transcriptional regulator
    • staphylococcal accessory regulator A
    • marR family protein
    • accessory regulator H1
    • HTH-type transcriptional regulator sarS
    • putative regulatory protein
    • SarS family transcriptional regulator
    • staphylococcal accessory regulator S
    • staphylococcal accessory regulator A, SarH2
    • HTH-type transcriptional regulator SarS (Staphylococcal accessoryregulator S)
  • strand?: -
  • coordinates?: 1178516..1179268
  • synteny block?: BlockID0004470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0096 (sarS)
    N315:
    SA0108 (sarH1)
    NCTC8325:
    Newman:
    NWMN_0056 (sarH1)
    USA300_FPR3757:
    04-02981:
    SA2981_0113 (sarH1)
    08BA02176:
    C248_0100 (sars)
    11819-97:
    MS7_0104 (sarS)
    71193:
    ST398NM01_0123
    ECT-R 2:
    ECTR2_68
    ED133:
    SAOV_0059 (sarS)
    ED98:
    SAAV_0080 (sarS)
    HO 5096 0412:
    SAEMRSA15_00780
    JH1:
    SaurJH1_0103
    JH9:
    SaurJH9_0099
    JKD6008:
    SAA6008_00090 (sarH2)
    JKD6159:
    SAA6159_00095 (sarH2)
    LGA251:
    SARLGA251_00870 (sarS)
    M013:
    M013TW_0102
    MRSA252:
    SAR0115
    MSHR1132:
    SAMSHR1132_00880
    MSSA476:
    SAS0086
    Mu3:
    SAHV_0111 (sarH1)
    Mu50:
    SAV0112 (sarH1)
    MW2:
    MW0085 (sarH1)
    RF122:
    SAB0051c (sarS)
    ST398:
    SAPIG0123
    T0131:
    SAT0131_00097
    TCH60:
    HMPREF0772_10385 (sarS)
    TW20:
    SATW20_01240 (sarS)
    USA300_TCH1516:
    USA300HOU_0123 (sarH1)
    VC40:
    SAVC_00300

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQENTLP
    N315            --------MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQENTLP
    NCTC8325        --------MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQENTLP
    Newman          MHIQGDKTMKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQENTLP
    USA300_FPR3757  --------MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQENTLP
                            ****************************************************

    COL             FKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFD
    N315            FKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFD
    NCTC8325        FKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFD
    Newman          FKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFD
    USA300_FPR3757  FKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFD
                    ************************************************************

    COL             QIIKQFNLADQSESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQNK
    N315            QIIKQFNLADQSESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQNK
    NCTC8325        QIIKQFNLADQSESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQNK
    Newman          QIIKQFNLADQSESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQNK
    USA300_FPR3757  QIIKQFNLADQSESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQNK
                    ************************************************************

    COL             NIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLL
    N315            NIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLL
    NCTC8325        NIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLL
    Newman          NIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLL
    USA300_FPR3757  NIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLL
                    ************************************************************

    COL             AQVNQLLADKDHLHLVFE
    N315            AQVNQLLADKDHLHLVFE
    NCTC8325        AQVNQLLADKDHLHLVFE
    Newman          AQVNQLLADKDHLHLVFE
    USA300_FPR3757  AQVNQLLADKDHLHLVFE
                    ******************