From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000916000
  • symbol?: sbnC
  • description?: IucA/IucC family protein

      descriptions from strain specific annotations:

    • IucA/IucC family protein
    • IucC family siderophore biosynthesis protein
    • Siderophore staphylobactin biosynthesis protein SbnC
    • siderophore biosynthesis IucC family protein
    • IucA/IucC family siderophore biosynthesis protein
    • putative siderophore biosynthesis protein
    • siderophore biosynthesis protein, IucC family
    • Siderophore biosynthesis IucC protein
  • strand?: +
  • coordinates?: 1184876..1186630
  • synteny block?: BlockID0004530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0062 (sbnC)
    USA300_FPR3757:
    04-02981:
    SA2981_0119 (sbnC)
    08BA02176:
    C248_0106
    11819-97:
    MS7_0110
    71193:
    ST398NM01_0129
    ECT-R 2:
    ECTR2_74
    ED133:
    SAOV_0065
    ED98:
    SAAV_0086
    HO 5096 0412:
    SAEMRSA15_00840
    JH1:
    SaurJH1_0109
    JH9:
    SaurJH9_0105
    JKD6008:
    SAA6008_00096 (sbnC)
    JKD6159:
    SAA6159_00101 (sbnC)
    LGA251:
    SARLGA251_00930 (sbnC)
    M013:
    M013TW_0108
    MRSA252:
    SAR0121
    MSHR1132:
    SAMSHR1132_00940
    MSSA476:
    SAS0092
    Mu3:
    SAHV_0117
    Mu50:
    SAV0118
    MW2:
    MW0091
    RF122:
    SAB0057
    ST398:
    SAPIG0129
    T0131:
    SAT0131_00104
    TCH60:
    HMPREF0772_10379 (sbnC)
    TW20:
    SATW20_01300 (sbnC)
    USA300_TCH1516:
    USA300HOU_0129
    VC40:
    SAVC_00330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQNHTAVNTAQAIILRDLVDALLFEDIAGIVSNSEITKENGQTLLIYERETQQIKIPVYF
    N315            MQNHTAVNTAQAIILRDLVDALLFEDIAGIVSNSEITKENGQTLLIYERETQQIKIPVYF
    NCTC8325        MQNHTAVNTAQAIILRDLVDALLFEDIAGIVSNSEITKENGQTLLIYERETQQIKIPVYF
    Newman          MQNHTAVNTAQAIILRDLVDALLFEDIAGIVSNSEITKENGQTLLIYERETQQIKIPVYF
    USA300_FPR3757  MQNHTAVNTAQAIILRDLVDALLFEDIAGIVSNSEITKENGQTLLIYERETQQIKIPVYF
                    ************************************************************

    COL             SALNMFRYESSQPITIEGRVSKQPLTAAEFWQTIANMNCDLSHEWEVARVEEGLTTAATQ
    N315            SALNMFRYESSQPITIEGRVSKQPLTAAEFWQTIANMNCDLSHEWEVARVEEGLTTAATQ
    NCTC8325        SALNMFRYESSQPITIEGRVSKQPLTAAEFWQTIANMNCDLSHEWEVARVEEGLTTAATQ
    Newman          SALNMFRYESSQPITIEGRVSKQPLTAAEFWQTIANMNCDLSHEWEVARVEEGLTTAATQ
    USA300_FPR3757  SALNMFRYESSQPITIEGRVSKQPLTAAEFWQTIANMNCDLSHEWEVARVEEGLTTAATQ
                    ************************************************************

    COL             LAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLREADYQVYQAELNQSFPLMVA
    N315            LAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLREADYQVYQAELNQSFPLMVA
    NCTC8325        LAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLREADYQVYQAELNQSFPLMVA
    Newman          LAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLREADYQVYQAELNQSFPLMVA
    USA300_FPR3757  LAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLREADYQVYQAELNQSFPLMVA
                    ************************************************************

    COL             AVKKTHMIHGDTANIDELENLTVPIKEQATDMLNDQGLSIDDYVLFPVHPWQYQHILPNV
    N315            AVKKTHMIHGDTANIDELENLTVPIKEQATDMLNDQGLSIDDYVLFPVHPWQYQHILPNV
    NCTC8325        AVKKTHMIHGDTANIDELENLTVPIKEQATDMLNDQGLSIDDYVLFPVHPWQYQHILPNV
    Newman          AVKKTHMIHGDTANIDELENLTVPIKEQATDMLNDQGLSIDDYVLFPVHPWQYQHILPNV
    USA300_FPR3757  AVKKTHMIHGDTANIDELENLTVPIKEQATDMLNDQGLSIDDYVLFPVHPWQYQHILPNV
                    ************************************************************

    COL             FAKEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKVPFAMQSLGALRLTPTRYMK
    N315            FATEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKVPFAMQSLGALRLTPTRYMK
    NCTC8325        FAKEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKVPFAMQSLGALRLTPTRYMK
    Newman          FAKEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKVPFAMQSLGALRLTPTRYMK
    USA300_FPR3757  FAKEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKVPFAMQSLGALRLTPTRYMK
                    **.*********************************************************

    COL             NGEQAEQLLRQLIEKDEALAKYVMVCDETAWWSYMGQDNDIFKDQLGHLTVQLRKYPEVL
    N315            NGEQAEQLLRQLIEKDEALAKYVMVCDETAWWSYMGQDNDIFKDQLGHLTVQLRKYPEVL
    NCTC8325        NGEQAEQLLRQLIEKDEALAKYVMVCDETAWWSYMGQDNDIFKDQLGHLTVQLRKYPEVL
    Newman          NGEQAEQLLRQLIEKDEALAKYVMVCDETAWWSYMGQDNDIFKDQLGHLTVQLRKYPEVL
    USA300_FPR3757  NGEQAEQLLRQLIEKDEALAKYVMVCDETAWWSYMGQDNDIFKDQLGHLTVQLRKYPEVL
                    ************************************************************

    COL             AKNDTQQLVSMAALAANDRTLYQMICGKDNISKNDVMTLFEDIAQVFLKVTLSFMQYGAL
    N315            AKNDTQQLVSMAALAANDRTLYQMICGKDNISKNDVMTLFEDIAQVFLKVTLSFMQYGAL
    NCTC8325        AKNDTQQLVSMAALAANDRTLYQMICGKDNISKNDVMTLFEDIAQVFLKVTLSFMQYGAL
    Newman          AKNDTQQLVSMAALAANDRTLYQMICGKDNISKNDVMTLFEDIAQVFLKVTLSFMQYGAL
    USA300_FPR3757  AKNDTQQLVSMAALAANDRTLYQMICGKDNISKNDVMTLFEDIAQVFLKVTLSFMQYGAL
                    ************************************************************

    COL             PELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAHQLSLPKYVVREDTPNTLINEDL
    N315            PELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAHQLSLPKYVVREDTPNTLINEDL
    NCTC8325        PELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAHQLSLPKYVVREDTPNTLINEDL
    Newman          PELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAHQLSLPKYVVREDTPNTLINEDL
    USA300_FPR3757  PELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAHQLSLPKYVVREDTPNTLINEDL
                    ************************************************************

    COL             ETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSLLKQILKNEVATISWVTTDQLAVR
    N315            ETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSLLKQILKNEVATISWVTTDQLAVR
    NCTC8325        ETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSLLKQILKNEVATISWVTTDQLAVR
    Newman          ETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSLLKQILKNEVATISWVTTDQLAVR
    USA300_FPR3757  ETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSLLKQILKNEVATISWVTTDQLAVR
                    ************************************************************

    COL             HILFDKQTWPFKQILLPLLYQRDSGGGSMPSGLTTVPNPMVTYD
    N315            HILFDKQTWPFKQILLPLLYQRDSGGGSMPSGLTTVPNPMVTYD
    NCTC8325        HILFDKQTWPFKQILLPLLYQRDSGGGSMPSGLTTVPNPMVTYD
    Newman          HILFDKQTWPFKQILLPLLYQRDSGGGSMPSGLTTVPNPMVTYD
    USA300_FPR3757  HILFDKQTWPFKQILLPLLYQRDSGGGSMPSGLTTVPNPMVTYD
                    ********************************************