From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000918000
  • symbol?: sbnD
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • drug transporter
    • membrane transporter protein
    • putative drug transporter
    • drug transporter, putative
    • major facilitator superfamily protein
    • major facilitator transporter
    • MFS family major facilitator transporter
    • multidrug resistance efflux pump
    • putative transport protein
    • Siderophore staphylobactin biosynthesis protein SbnD
    • transport protein
  • strand?: +
  • coordinates?: 1186623..1187879
  • synteny block?: BlockID0004550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0063 (sbnD)
    USA300_FPR3757:
    04-02981:
    SA2981_0120 (sbnD)
    08BA02176:
    C248_0107
    11819-97:
    MS7_0111
    71193:
    ST398NM01_0130
    ECT-R 2:
    ECTR2_75
    ED133:
    SAOV_0066
    ED98:
    SAAV_0087
    HO 5096 0412:
    SAEMRSA15_00850
    JH1:
    SaurJH1_0110
    JH9:
    SaurJH9_0106
    JKD6008:
    SAA6008_00097 (sbnD)
    JKD6159:
    SAA6159_00102 (sbnD)
    LGA251:
    SARLGA251_00940 (sbnD)
    M013:
    M013TW_0109
    MRSA252:
    SAR0122
    MSHR1132:
    SAMSHR1132_00950
    MSSA476:
    SAS0093
    Mu3:
    SAHV_0118
    Mu50:
    SAV0119
    MW2:
    MW0092
    RF122:
    SAB0058
    ST398:
    SAPIG0131
    T0131:
    SAT0131_00105
    TCH60:
    HMPREF0772_10378
    TW20:
    SATW20_01310 (sbnD)
    USA300_TCH1516:
    USA300HOU_0130
    VC40:
    SAVC_00335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINQSIWRSNFRILWLSQFIAIAGLTVLVPLLPIYMASLQNLSVVEIQLWSGIAIAAPAV
    N315            MINQSIWRSNFRILWLSQFIAIAGLTVLVPLLPIYMASLQNLSVVEIQLWSGIAIAAPAV
    NCTC8325        MINQSIWRSNFRILWLSQFIAIAGLTVLVPLLPIYMASLQNLSVVEIQLWSGIAIAAPAV
    Newman          MINQSIWRSNFRILWLSQFIAIAGLTVLVPLLPIYMASLQNLSVVEIQLWSGIAIAAPAV
    USA300_FPR3757  MINQSIWRSNFRILWLSQFIAIAGLTVLVPLLPIYMASLQNLSVVEIQLWSGIAIAAPAV
                    ************************************************************

    COL             TTMIASPIWGKLGDKISRKWMVLRALLGLAVCLFLMALCTTPLQFVLVRLLQGLFGGVVD
    N315            TTMIASPIWGKLGDKISRKWMVLRALLGLAVCLFLMALCTTPLQFVLVRLLQGLFGGVVD
    NCTC8325        TTMIASPIWGKLGDKISRKWMVLRALLGLAVCLFLMALCTTPLQFVLVRLLQGLFGGVVD
    Newman          TTMIASPIWGKLGDKISRKWMVLRALLGLAVCLFLMALCTTPLQFVLVRLLQGLFGGVVD
    USA300_FPR3757  TTMIASPIWGKLGDKISRKWMVLRALLGLAVCLFLMALCTTPLQFVLVRLLQGLFGGVVD
                    ************************************************************

    COL             ASSAFASAEAPAEDRGKVLGRLQSSVSAGSLVGPLIGGVTASILGFSALLMSIAVITFIV
    N315            ASSAFASAEAPAEDRGKVLGRLQSSVSAGSLVGPLIGGVTASILGFSALLMSIAVITFIV
    NCTC8325        ASSAFASAEAPAEDRGKVLGRLQSSVSAGSLVGPLIGGVTASILGFSALLMSIAVITFIV
    Newman          ASSAFASAEAPAEDRGKVLGRLQSSVSAGSLVGPLIGGVTASILGFSALLMSIAVITFIV
    USA300_FPR3757  ASSAFASAEAPAEDRGKVLGRLQSSVSAGSLVGPLIGGVTASILGFSALLMSIAVITFIV
                    ************************************************************

    COL             CIFGALKLIETTHMPKSQTPNINKGIRRSFQCLLCTQQTCRFIIVGVLANFAMYGMLTAL
    N315            CIFGALKLIETTHMPKSQTPNINKGIRRSFQCLLCTQQTCRFIIVGVLANFAMYGMLTAL
    NCTC8325        CIFGALKLIETTHMPKSQTPNINKGIRRSFQCLLCTQQTCRFIIVGVLANFAMYGMLTAL
    Newman          CIFGALKLIETTHMPKSQTPNINKGIRRSFQCLLCTQQTCRFIIVGVLANFAMYGMLTAL
    USA300_FPR3757  CIFGALKLIETTHMPKSQTPNINKGIRRSFQCLLCTQQTCRFIIVGVLANFAMYGMLTAL
                    ************************************************************

    COL             SPLASSVNHTAIDDRSVIGFLQSAFWTASILSAPLWGRFNDKSYVKSVYIFATIACGCSA
    N315            SPLASSVNHTAIDDRSVIGFLQSAFWTASILSAPLWGRFNDKSYVKSVYIFATIACGCSA
    NCTC8325        SPLASSVNHTAIDDRSVIGFLQSAFWTASILSAPLWGRFNDKSYVKSVYIFATIACGCSA
    Newman          SPLASSVNHTAIDDRSVIGFLQSAFWTASILSAPLWGRFNDKSYVKSVYIFATIACGCSA
    USA300_FPR3757  SPLASSVNHTAIDDRSVIGFLQSAFWTASILSAPLWGRFNDKSYVKSVYIFATIACGCSA
                    ************************************************************

    COL             ILQGLATNIEFLMAARILQGLTYSALIQSVMFVVVNACHQQLKGTFVGTTNSMLVVGQII
    N315            ILQGLATNIEFLMAARILQGLTYSALIQSVMFVVVNACHQQLKGTFVGTTNSMLVVGQII
    NCTC8325        ILQGLATNIEFLMAARILQGLTYSALIQSVMFVVVNACHQQLKGTFVGTTNSMLVVGQII
    Newman          ILQGLATNIEFLMAARILQGLTYSALIQSVMFVVVNACHQQLKGTFVGTTNSMLVVGQII
    USA300_FPR3757  ILQGLATNIEFLMAARILQGLTYSALIQSVMFVVVNACHQQLKGTFVGTTNSMLVVGQII
                    ************************************************************

    COL             GSLSGAAITSYTTPATTFIVMGVVFAVSSLFLICSTITNQINDHTLMKLWELKQKSAK
    N315            GSLSGAAITSYTTPATTFIVMGVVFAVSSLFLICSTITNQINDHTLMKLWELKQKSAK
    NCTC8325        GSLSGAAITSYTTPATTFIVMGVVFAVSSLFLICSTITNQINDHTLMKLWELKQKSAK
    Newman          GSLSGAAITSYTTPATTFIVMGVVFAVSSLFLICSTITNQINDHTLMKLWELKQKSAK
    USA300_FPR3757  GSLSGAAITSYTTPATTFIVMGVVFAVSSLFLICSTITNQINDHTLMKLWELKQKSAK
                    **********************************************************