From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000919000
  • symbol?: sbnE
  • description?: IucA/IucC family protein

      descriptions from strain specific annotations:

    • IucA/IucC family protein
    • IucA family siderophore biosynthesis protein
    • Siderophore staphylobactin biosynthesis protein SbnE
    • IucA/IucC family siderophore biosynthesis protein
    • siderophore biosynthesis IucA family protein
    • putative siderophore biosynthesis protein
    • siderophore biosynthesis protein, IucA/IucC family
    • amino-acid citrate synthetase
    • staphylobactin siderophore biosynthesis protein SbnE
  • strand?: +
  • coordinates?: 1187869..1189593
  • synteny block?: BlockID0004560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0064 (sbnE)
    USA300_FPR3757:
    04-02981:
    SA2981_0121 (sbnE)
    08BA02176:
    C248_0108
    11819-97:
    MS7_0112
    71193:
    ST398NM01_0132
    ECT-R 2:
    ECTR2_76
    ED133:
    SAOV_0067
    ED98:
    SAAV_0088
    HO 5096 0412:
    SAEMRSA15_00860
    JH1:
    SaurJH1_0111
    JH9:
    SaurJH9_0107
    JKD6008:
    SAA6008_00098 (sbnE)
    JKD6159:
    SAA6159_00103 (sbnE)
    LGA251:
    SARLGA251_00950 (sbnE)
    M013:
    M013TW_0110
    MRSA252:
    SAR0123
    MSHR1132:
    SAMSHR1132_00960
    MSSA476:
    SAS0094
    Mu3:
    SAHV_0119
    Mu50:
    SAV0120
    MW2:
    MW0093
    RF122:
    SAB0059
    ST398:
    SAPIG0132
    T0131:
    SAT0131_00106
    TCH60:
    HMPREF0772_10377 (sbnE)
    TW20:
    SATW20_01320 (sbnE)
    USA300_TCH1516:
    USA300HOU_0131
    VC40:
    SAVC_00340

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQNKELIQHAAYAAIERILNEYFREENLYQVPPQNHQWSIQLSELETLTGEFRYWSAMGH
    N315            MQNKELIQHAAYAAIERILNEYFREENLYQVPPQNHQWSIQLSELETLTGEFRYWSAMGH
    NCTC8325        MQNKELIQHAAYAAIERILNEYFREENLYQVPPQNHQWSIQLSELETLTGEFRYWSAMGH
    Newman          MQNKELIQHAAYAAIERILNEYFREENLYQVPPQNHQWSIQLSELETLTGEFRYWSAMGH
    USA300_FPR3757  MQNKELIQHAAYAAIERILNEYFREENLYQVPPQNHQWSIQLSELETLTGEFRYWSAMGH
                    ************************************************************

    COL             HMYHPEVWLIDGKSKKITTYKEAIARILQHMAQSADNQTAVQQHMAQIMSDIDNSIHRTA
    N315            HMYHPEVWLIDGKSKKITTYKEAIARILQHMAQSADNQTAVQQHMAQIMSDIDNSIHRTA
    NCTC8325        HMYHPEVWLIDGKSKKITTYKEAIARILQHMAQSADNQTAVQQHMAQIMSDIDNSIHRTA
    Newman          HMYHPEVWLIDGKSKKITTYKEAIARILQHMAQSADNQTAVQQHMAQIMSDIDNSIHRTA
    USA300_FPR3757  HMYHPEVWLIDGKSKKITTYKEAIARILQHMAQSADNQTAVQQHMAQIMSDIDNSIHRTA
                    ************************************************************

    COL             RYLQSNTIDYVEDRYIVSEQSLYLGHPFHPTPKSASGFSEADLEKYAPECHTSFQLHYLA
    N315            RYLQSNTIDYVEDRYIVSEQSLYLGHPFHPTPKSASGFSEADLEKYAPECHTSFQLHYLA
    NCTC8325        RYLQSNTIDYVEDRYIVSEQSLYLGHPFHPTPKSASGFSEADLEKYAPECHTSFQLHYLA
    Newman          RYLQSNTIDYVEDRYIVSEQSLYLGHPFHPTPKSASGFSEADLEKYAPECHTSFQLHYLA
    USA300_FPR3757  RYLQSNTIDYVEDRYIVSEQSLYLGHPFHPTPKSASGFSEADLEKYAPECHTSFQLHYLA
                    ************************************************************

    COL             VHQDVLLTRYVEGKEDQVEKVLYQLADIDISEIPKDFILLPTHPYQINVLRQHPQYMQYS
    N315            VHQDVLLTRYVEGKEDQVEKVLYQLADIDISEIPKDFILLPTHPYQINVLRQHPQYMQYS
    NCTC8325        VHQDVLLTRYVEGKEDQVEKVLYQLADIDISEIPKDFILLPTHPYQINVLRQHPQYMQYS
    Newman          VHQDVLLTRYVEGKEDQVEKVLYQLADIDISEIPKDFILLPTHPYQINVLRQHPQYMQYS
    USA300_FPR3757  VHQDVLLTRYVEGKEDQVEKVLYQLADIDISEIPKDFILLPTHPYQINVLRQHPQYMQYS
                    ************************************************************

    COL             EQGLIKDLGVSGDSVYPTSSVRTVFSKALNIYLKLPIHVKITNFIRTNDLEQIERTIDAA
    N315            EQGLIKDLGVSGDLVYPTSSVRTVFSKALNIYLKLPIHVKITNFIRTNDLEQIERTIDAA
    NCTC8325        EQGLIKDLGVSGDSVYPTSSVRTVFSKALNIYLKLPIHVKITNFIRTNDLEQIERTIDAA
    Newman          EQGLIKDLGVSGDSVYPTSSVRTVFSKALNIYLKLPIHVKITNFIRTNDLEQIERTIDAA
    USA300_FPR3757  EQGLIKDLGVSGDSVYPTSSVRTVFSKALNIYLKLPIHVKITNFIRTNDLEQIERTIDAA
                    ************* **********************************************

    COL             QVIASVKDEVETPHFKLMFEEGYRALLPNPLGQTVEPEMDLLTNSAMIVREGIPNYHADK
    N315            QVIASVKDEVETPHFKLMFEEGYRALLPNPLGQTVEPEMDLLTNSAMIVREGIPNYHADK
    NCTC8325        QVIASVKDEVETPHFKLMFEEGYRALLPNPLGQTVEPEMDLLTNSAMIVREGIPNYHADK
    Newman          QVIASVKDEVETPHFKLMFEEGYRALLPNPLGQTVEPEMDLLTNSAMIVREGIPNYHADK
    USA300_FPR3757  QVIASVKDEVETPHFKLMFEEGYRALLPNPLGQTVEPEMDLLTNSAMIVREGIPNYHADK
                    ************************************************************

    COL             DIHVLASLFETMPDSPMSKLSQVIEQSGLAPEAWLECYLNRTLLPILKLFSNTGISLEAH
    N315            DIHVLASLFETMPDSPISKLAQVIEQSGLAPEAWLECYLDRTLLPILKLFSNTGISLEAH
    NCTC8325        DIHVLASLFETMPDSPMSKLSQVIEQSGLAPEAWLECYLNRTLLPILKLFSNTGISLEAH
    Newman          DIHVLASLFETMPDSPMSKLSQVIEQSGLAPEAWLECYLNRTLLPILKLFSNTGISLEAH
    USA300_FPR3757  DIHVLASLFETMPDSPMSKLSQVIEQSGLAPEAWLECYLNRTLLPILKLFSNTGISLEAH
                    ****************:***:******************:********************

    COL             VQNTLIELKDGIPDVCFVRDLEGICLSRTIATEKQLVPNVVAASSPVVYAHDEAWHRLKY
    N315            VQNTLIELKDGIPDVCFVRDLEGICLSRTIATEKQLVPNVVAASSPVVYAHDEAWHRLKY
    NCTC8325        VQNTLIELKDGIPDVCFVRDLEGICLSRTIATEKQLVPNVVAASSPVVYAHDEAWHRLKY
    Newman          VQNTLIELKDGIPDVCFVRDLEGICLSRTIATEKQLVPNVVAASSPVVYAHDEAWHRLKY
    USA300_FPR3757  VQNTLIELKDGIPDVCFVRDLEGICLSRTIATEKQLVPNVVAASSPVVYAHDEAWHRLKY
                    ************************************************************

    COL             YVVVNHLGHLVSTIGKATRNEVVLWQLVAHRLMTWKKEYANNAVFVDCVEDLYQTPTIAA
    N315            YVVVNHLGHLVSTIGKATRNEVVLWQLVAHRLMTWKKEYANNAVFVDCVEDLYQTPTIAA
    NCTC8325        YVVVNHLGHLVSTIGKATRNEVVLWQLVAHRLMTWKKEYANNAVFVDCVEDLYQTPTIAA
    Newman          YVVVNHLGHLVSTIGKATRNEVVLWQLVAHRLMTWKKEYANNAVFVDCVEDLYQTPTIAA
    USA300_FPR3757  YVVVNHLGHLVSTIGKATRNEVVLWQLVAHRLMTWKKEYANNAVFVDCVEDLYQTPTIAA
                    ************************************************************

    COL             KANLMSKLNDCGANPIYTHIPNPICHNKEVSYCESNNS
    N315            KANLMSKLNDCGANPIYTHIPNPICYNKEVSYCESNNS
    NCTC8325        KANLMSKLNDCGANPIYTHIPNPICHNKEVSYCESNNS
    Newman          KANLMSKLNDCGANPIYTHIPNPICHNKEVSYCESNNS
    USA300_FPR3757  KANLMSKLNDCGANPIYTHIPNPICHNKEVSYCESNNS
                    *************************:************