From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000935000
  • symbol?: galE
  • description?: NAD-dependent epimerase/dehydratase family protein

      descriptions from strain specific annotations:

    • NAD-dependent epimerase/dehydratase family protein
    • UDP-glucose 4-epimerase
    • putative UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase)
    • polysaccharide biosynthesis family protein
  • strand?: +
  • coordinates?: 1197479..1198459
  • synteny block?: BlockID0004720
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0129
    08BA02176:
    C248_0117
    11819-97:
    MS7_0119
    71193:
    ST398NM01_0141
    ECT-R 2:
    ECTR2_84
    ED133:
    SAOV_0076
    ED98:
    SAAV_0096
    HO 5096 0412:
    SAEMRSA15_00950
    JH1:
    SaurJH1_0119
    JH9:
    SaurJH9_0114
    JKD6008:
    SAA6008_00106
    JKD6159:
    SAA6159_00111
    LGA251:
    SARLGA251_01030
    M013:
    M013TW_0118
    MRSA252:
    SAR0130
    MSHR1132:
    SAMSHR1132_01040
    MSSA476:
    SAS0102
    Mu3:
    SAHV_0127
    Mu50:
    SAV0128
    MW2:
    MW0102
    RF122:
    SAB0067
    ST398:
    T0131:
    SAT0131_00115 (ispA)
    TCH60:
    HMPREF0772_10370 (galE2)
    TW20:
    SATW20_01390
    USA300_TCH1516:
    USA300HOU_0140 (galE)
    VC40:
    SAVC_00380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREY
    N315            ---MERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREY
    NCTC8325        MEDLERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREY
    Newman          -------MITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREY
    USA300_FPR3757  MEDLERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREY
                           :****************************************************

    COL             DAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNNHIKRFI
    N315            DAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNSHIKRFI
    NCTC8325        DAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNNHIKRFI
    Newman          DAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNNHIKRFI
    USA300_FPR3757  DAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNNHIKRFI
                    *****************************************************.******

    COL             FASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFG
    N315            FASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFG
    NCTC8325        FASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFG
    Newman          FASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFG
    USA300_FPR3757  FASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFG
                    ************************************************************

    COL             PRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGH
    N315            PRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGH
    NCTC8325        PRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGH
    Newman          PRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGH
    USA300_FPR3757  PRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGH
                    ************************************************************

    COL             GYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTV
    N315            GYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTV
    NCTC8325        GYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTV
    Newman          GYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTV
    USA300_FPR3757  GYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTV
                    ************************************************************

    COL             ETGLKDYFNFEVDNIEEVTAKEVEMS
    N315            ETGLKDYFNFEVDNIEEVTAKEVEMS
    NCTC8325        ETGLKDYFNFEVDNIEEVTAKEVEMS
    Newman          ETGLKDYFNFEVDNIEEVTAKEVEMS
    USA300_FPR3757  ETGLKDYFNFEVDNIEEVTAKEVEMS
                    **************************