From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000943000
  • symbol?: sasD
  • description?: cell wall anchor domain-containing protein

      descriptions from strain specific annotations:

    • cell wall anchor domain-containing protein
    • cell-wall-anchored protein SasD (LPXAG motif)
    • LPXTG-motif cell wall anchor domain-containing protein
    • cell wall surface anchor family protein
    • cell wall surface anchor protein
    • surface anchored protein
    • putative LPXAG surface protein
  • strand?: +
  • coordinates?: 1204428..1205036
  • synteny block?: BlockID0004790
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0135
    08BA02176:
    C248_0123 (sasD)
    11819-97:
    MS7_0125
    71193:
    ST398NM01_0148
    ECT-R 2:
    ECTR2_90
    ED133:
    ED98:
    SAAV_0102
    HO 5096 0412:
    JH1:
    SaurJH1_0125
    JH9:
    SaurJH9_0120
    JKD6008:
    SAA6008_00112 (sasD)
    JKD6159:
    SAA6159_00117 (sasD)
    LGA251:
    M013:
    MRSA252:
    SAR0136 (sasD)
    MSHR1132:
    SAMSHR1132_01100
    MSSA476:
    SAS0108
    Mu3:
    SAHV_0133
    Mu50:
    SAV0134
    MW2:
    MW0108
    RF122:
    SAB0073
    ST398:
    SAPIG0148
    T0131:
    SAT0131_00122
    TCH60:
    HMPREF0772_10364 (sasD)
    TW20:
    SATW20_01450 (sasD)
    USA300_TCH1516:
    USA300HOU_0146 (sasD)
    VC40:
    SAVC_00410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVSNKQSQNVQNHRPYGGVVPQGMTQA
    N315            MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVPNKQSQNVQNHRPYGGVVPQGMTQA
    NCTC8325        MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVSNKQSQNVQNHRPYGGVVPQGMTQA
    Newman          MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVSNKQSQNVQNHRPYGGVVPQGMTQA
    USA300_FPR3757  MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVSNKQSQNVQNHRPYGGVVPQGMTQA
                    ***********************************.************************

    COL             QYTELEKALPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNVGVFKPHAVRDMNGHAL
    N315            QYTELEKTLPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNVGVFKPHAVRDMNGHAL
    NCTC8325        QYTELEKALPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNVGVFKPHAVRDMNGHAL
    Newman          QYTELEKALPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNVGVFKPHAVRDMNGHAL
    USA300_FPR3757  QYTELEKALPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNVGVFKPHAVRDMNGHAL
                    *******:****************************************************

    COL             PLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQGHMNQNTHMNQQPHMQQGH--MQS
    N315            PLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQDHMNQNTHMNQQPQIQQGH--MQS
    NCTC8325        PLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQGHMNQNTHEPTATHATRSYAIIKP
    Newman          PLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQGHMNQNTHMNQQPHMQQGH--MQS
    USA300_FPR3757  PLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQGHMNQNTHMNQQPHMQQGH--MQS
                    ************************************.*******    .:  :.:  ::.

    COL             SNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIAALLLVSGLFLAFRRRS
    N315            SNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIAALLLVSGLFLAFRRRS
    NCTC8325        SNDESKSKYAFIKSSNEP------------------------------------------
    Newman          SNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIAALLLVSGLFLAFRRRS
    USA300_FPR3757  SNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIAALLLVSGLFLAFRRRS
                    **.:  *  * ::***.                                           

    COL             TNK
    N315            TNK
    NCTC8325        --K
    Newman          TNK
    USA300_FPR3757  TNK
                      *