From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000949000
  • symbol?: tet38
  • description?: tetracycline efflux MFS transporter Tet(38)

      descriptions from strain specific annotations:

    • tetracycline efflux MFS transporter Tet(38)
    • tetracycline resistance protein
    • putative tetracycline resistance protein
    • major facilitator superfamily protein
    • major facilitator superfamily tetracycline:cation symporter
    • major facilitator transporter
    • membrane transporter
    • MFS family major facilitator transporter, tetracycline:cation symporter
    • Permease
    • probable membrane transport protein
    • putative transport system protein
    • tetracycline resistance like-protein
    • tetracycline resistance protein, putative
    • transmembrane protein
    • transport system protein
  • strand?: +
  • coordinates?: 1209306..1210667
  • synteny block?: BlockID0004850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0138
    08BA02176:
    C248_0126
    11819-97:
    MS7_0128
    71193:
    ST398NM01_0151
    ECT-R 2:
    ECTR2_93
    ED133:
    SAOV_0084
    ED98:
    SAAV_0105
    HO 5096 0412:
    SAEMRSA15_01030
    JH1:
    SaurJH1_0128
    JH9:
    SaurJH9_0123
    JKD6008:
    SAA6008_00115
    JKD6159:
    SAA6159_00120
    LGA251:
    SARLGA251_01110 (tet38)
    M013:
    M013TW_0127
    MRSA252:
    SAR0139
    MSHR1132:
    SAMSHR1132_01130
    MSSA476:
    SAS0111
    Mu3:
    SAHV_0136
    Mu50:
    SAV0137
    MW2:
    MW0111
    RF122:
    SAB0076
    ST398:
    SAPIG0151
    T0131:
    SAT0131_00126
    TCH60:
    HMPREF0772_10361
    TW20:
    SATW20_01480 (tet38)
    USA300_TCH1516:
    USA300HOU_0149
    VC40:
    SAVC_00430

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVTTVSWQATLAGLVIGI
    N315            MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVTTVSWQATLAGLVIGI
    NCTC8325        MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVTTVSWQATLAGLVIGI
    Newman          MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVTTVSWQATLAGLVIGI
    USA300_FPR3757  MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVTTVSWQATLAGLVIGI
                    ************************************************************

    COL             GAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFPLLLVGRIIQTAGLAAAETLY
    N315            GAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFPLLLVGRIIQTAGLAAAETLY
    NCTC8325        GAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFPLLLVGRIIQTAGLAAAETLY
    Newman          GAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFPLLLVGRIIQTAGLAAAETLY
    USA300_FPR3757  GAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFPLLLVGRIIQTAGLAAAETLY
                    ************************************************************

    COL             VIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLHWTNMFLIALIVVFTLPF
    N315            VIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLHWTNMFLIALIVVFTLPF
    NCTC8325        VIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLHWTNMFLIALIVVFTLPF
    Newman          VIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLHWTNMFLIALIVVFTLPF
    USA300_FPR3757  VIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLHWTNMFLIALIVVFTLPF
                    ************************************************************

    COL             LFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLYMIGALIAIIVFALYIKNA
    N315            LFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLYMIGALIAIIVFALYIKNA
    NCTC8325        LFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLYMIGALIAIIVFALYIKNA
    Newman          LFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLYMIGALIAIIVFALYIKNA
    USA300_FPR3757  LFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLYMIGALIAIIVFALYIKNA
                    ************************************************************

    COL             QRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIMEQIYHLQLDTTSLLLVPGYI
    N315            QRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIMEQIYHLQLDTTSLLLVPGYI
    NCTC8325        QRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIMEQIYHLQLDTTSLLLVPGYI
    Newman          QRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIMEQIYHLQLDTTSLLLVPGYI
    USA300_FPR3757  QRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIMEQIYHLQLDTTSLLLVPGYI
                    ************************************************************

    COL             VAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAVGNHISIFVISMIFFAGSFAL
    N315            VAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAVGNHISIFVISMIFFAGSFAL
    NCTC8325        VAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAVGNHISIFVISMIFFAGSFAL
    Newman          VAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAVGNHISIFVISMIFFAGSFAL
    USA300_FPR3757  VAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAVGNHISIFVISMIFFAGSFAL
                    ************************************************************

    COL             MYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAIAAALIDFKALNFPGNDALSSH
    N315            MYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAIAAALIDFKALNFPGNDALSSH
    NCTC8325        MYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAIAAALIDFKALNFPGNDALSSH
    Newman          MYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAIAAALIDFKALNFPGNDALSSH
    USA300_FPR3757  MYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAIAAALIDFKALNFPGNDALSSH
                    ************************************************************

    COL             FGIILIILGLMSIVGLVLFVSLNRWTQSEK
    N315            FGIILIILGLMSIVGLVLFVILNRWTQSEK
    NCTC8325        FGIILIILGLMSIVGLVLFVSLNRWTQSEK
    Newman          FGIILIILGLMSIVGLVLFVSLNRWTQSEK
    USA300_FPR3757  FGIILIILGLMSIVGLVLFVSLNRWTQSEK
                    ******************** *********