From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000959000
  • symbol?:
  • description?: 5'-nucleotidase domain-containing protein

      descriptions from strain specific annotations:

    • 5'-nucleotidase domain-containing protein
    • 2,3-cyclic-nucleotide 2-phosphodiesterase
    • 2'-3'-cyclic-nucleotide 2'-phosphodiesterase
    • 5' nucleotidase family protein
    • putative nucleotidase
    • Nucleotidase
  • strand?: +
  • coordinates?: 1219452..1220953
  • synteny block?: BlockID0004940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0146
    08BA02176:
    C248_0134
    11819-97:
    MS7_0136
    71193:
    ST398NM01_0159
    ECT-R 2:
    ECTR2_102
    ED133:
    SAOV_0092
    ED98:
    SAAV_0113
    HO 5096 0412:
    SAEMRSA15_01110
    JH1:
    SaurJH1_0136
    JH9:
    SaurJH9_0131
    JKD6008:
    SAA6008_00123 (ushA)
    JKD6159:
    SAA6159_00128 (ushA)
    LGA251:
    SARLGA251_01190
    M013:
    M013TW_0135
    MRSA252:
    SAR0147
    MSHR1132:
    SAMSHR1132_01210
    MSSA476:
    SAS0119
    Mu3:
    SAHV_0144
    Mu50:
    SAV0145
    MW2:
    MW0119
    RF122:
    SAB0086 (cpdB)
    ST398:
    SAPIG0159
    T0131:
    SAT0131_00134
    TCH60:
    HMPREF0772_10353
    TW20:
    SATW20_01560
    USA300_TCH1516:
    USA300HOU_0157
    VC40:
    SAVC_00470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MSNIAFYVVSDVHGYIFPTDFTSRNQYQPMGLLLANHVIEQDRRQYDQSFKIDNGDFL
    N315            --MSNIAFYVVSDVHGYIFPTDFTSRNQYQPMGLLLANHVIEQDRRQYDQSFKIDNGDFL
    NCTC8325        --MSNIAFYVVSDVHGYIFPTDFTSRNQYQPMGLLLANHVIEQDRRQYDQSFKIDNGDFL
    Newman          MRMSNIAFYVVSDVHGYIFPTDFTSRNQYQPMGLLLANHVIEQDRRQYDQSFKIDNGDFL
    USA300_FPR3757  --MSNIAFYVVSDVHGYIFPTDFTSRNQYQPMGLLLANHVIEQDRRQYDQSFKIDNGDFL
                      **********************************************************

    COL             QGSPFCNYLIAHSGSSQPLVDFYNRMAFDFGTLGNHEFNYGLPYLKDTLRRLNYPVLCAN
    N315            QGSPFCNYLIAHSGSSQPLVDFYNQMAFDFGTLGNHEFNYGLPYLKDTLRRLNYPVLCAN
    NCTC8325        QGSPFCNYLIAHSGSSQPLVDFYNRMAFDFGTLGNHEFNYGLPYLKDTLRRLNYPVLCAN
    Newman          QGSPFCNYLIAHSGSSQPLVDFYNRMAFDFGTLGNHEFNYGLPYLKDTLRRLNYPVLCAN
    USA300_FPR3757  QGSPFCNYLIAHSGSSQPLVDFYNRMAFDFGTLGNHEFNYGLPYLKDTLRRLNYPVLCAN
                    ************************:***********************************

    COL             IYENDSTLTDNGVKYFQVGDQTVGVIGLTTQFIPHWEQPEHIQSLTFHSAFEILQQYLPE
    N315            IYENDSTLTDNGVQYFQVGDQTVGVIGLTTQFIPHWEQPEHIQSLTFHSAFETLQQHLPE
    NCTC8325        IYENDSTLTDNGVKYFQVGDQTVGVIGLTTQFIPHWEQPEHIQSLTFHSAFEILQQYLPE
    Newman          IYENDSTLTDNGVKYFQVGDQTVGVIGLTTQFIPHWEQPEHIQSLTFHSAFEILQQYLPE
    USA300_FPR3757  IYENDSTLTDNGVKYFQVGDQTVGVIGLTTQFIPHWEQPEHIQSLTFHSAFEILQQYLPE
                    *************:************************************** ***:***

    COL             MKRHADIIVVCYHGGFEKDLESGTPTEVLTGENEGYAMLEAFSKDIDIFITGHQHRQIAE
    N315            MKRHADIIVVCYHGGFEKDLENGTPTEVLTGENEGYAMLEAFSKDIDIFITGHQHRQIAE
    NCTC8325        MKRHADIIVVCYHGGFEKDLESGTPTEVLTGENEGYAMLEAFSKDIDIFITGHQHRQIAE
    Newman          MKRHADIIVVCYHGGFEKDLESGTPTEVLTGENEGYAMLEAFSKDIDIFITGHQHRQIAE
    USA300_FPR3757  MKRHADIIVVCYHGGFEKDLESGTPTEVLTGENEGYAMLEAFSKDIDIFITGHQHRQIAE
                    *********************.**************************************

    COL             RFKQTAVIQPGTRGTTVGRVVLSTDEYENLSVESCELLPVIDDSTFTIDEDDQHLRKQLE
    N315            RFKQTAVIQPGTRGTTVGKVVLSTDEYENVSVESCELLPVIDDSTFTIDEDDQHLRKQLE
    NCTC8325        RFKQTAVIQPGTRGTTVGRVVLSTDEYENLSVESCELLPVIDDSTFTIDEDDQHLRKQLE
    Newman          RFKQTAVIQPGTRGTTVGRVVLSTDEYENLSVESCELLPVIDDSTFTIDEDDQHLRKQLE
    USA300_FPR3757  RFKQTAVIQPGTRGTTVGRVVLSTDEYENLSVESCELLPVIDDSTFTIDEDDQHLRKQLE
                    ******************:**********:******************************

    COL             DWLDYEITTLPYDMTINHAFEARVAPHPFTNFMNYALLEKSDADVACTALFDSASGFKQV
    N315            DWLDYEITTLPYDMTINHAFEARVAPHPFTNFMNYALLEKSDADVACTALFDSASGFKQV
    NCTC8325        DWLDYEITTLPYDMTINHAFEARVAPHPFTNFMNYALLEKSDADVACTALFDSASGFKQV
    Newman          DWLDYEITTLPYDMTINHAFEARVAPHPFTNFMNYALLEKSDADVACTALFDSASGFKQV
    USA300_FPR3757  DWLDYEITTLPYDMTINHAFEARVAPHPFTNFMNYALLEKSDADVACTALFDSASGFKQV
                    ************************************************************

    COL             VTMRDVINNYPFPNTFKVLAVSGAKLKEAIERSAEYFDVKNDEVSVSADFLEPKPQHFNY
    N315            VTMRDVINNYPFPNTFKVLAVSGAKLKEAIERSAEYFDVQNDEVSVSADFLGPKPQHFNY
    NCTC8325        VTMRDVINNYPFPNTFKVLAVSGAKLKEAIERSAEYFDVKNDEVSVSADFLEPKPQHFNY
    Newman          VTMRDVINNYPFPNTFKVLAVSGAKLKEAIERSAEYFDVKNDEVSVSADFLEPKPQHFNY
    USA300_FPR3757  VTMRDVINNYPFPNTFKVLAVSGAKLKEAIERSAEYFDVKNDEVSVSADFLEPKPQHFNY
                    ***************************************:*********** ********

    COL             DIYGGVSYTIHVGRPKGQRVSNMMIQGHAVDLKQTYTICVNNYRAVGGGQYDMYIDAPVV
    N315            DIYGGVSYTIHVGRPKGQRVSNMMIQGHAVDLKQTYTICVNNYRAVGGGQYDMFIDAPVV
    NCTC8325        DIYGGVSYTIHVGRPKGQRVSNMMIQGHAVDLKQTYTICVNNYRAVGGGQYDMYIDAPVV
    Newman          DIYGGVSYTIHVGRPKGQRVSNMMIQGHAVDLKQTYTICVNNYRAVGGGQYDMYIDAPVV
    USA300_FPR3757  DIYGGVSYTIHVGRPKGQRVSNMMIQGHAVDLKQTYTICVNNYRAVGGGQYDMYIDAPVV
                    *****************************************************:******

    COL             KDIQVEGAQLLIDFLSNNNLMRIPQVVDFKVEK
    N315            KDIQVEGAQLLIDFLSNNNLMRIPQVVDFKVEK
    NCTC8325        KDIQVEGAQLLIDFLSNNNLMRIPQVVDFKVEK
    Newman          KDIQVEGAQLLIDFLSNNNLMRIPQVVDFKVEK
    USA300_FPR3757  KDIQVEGAQLLIDFLSNNNLMRIPQVVDFKVEK
                    *********************************