From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000975000
  • symbol?: capB
  • description?: capsular polysaccharide biosynthesis protein Cap5B

      descriptions from strain specific annotations:

    • capsular polysaccharide biosynthesis protein Cap5B
    • capsular polysaccharide synthesis protein Cap5B
    • capsular polysaccharide synthesis enzyme CapB
    • capsular polysaccharide biosynthesis protein CapB
    • capsular polysaccharide synthesis enzyme Cap5B
    • capsular polysaccharide synthesis enzyme Cap8B
    • exopolysaccharide tyrosine-protein kinase
    • Non-specific protein-tyrosine kinase
    • putative tyrosine-protein kinase capB
    • Tyrosine-protein kinase (capsular polysaccharide biosynthesis)
    • Tyrosine-protein kinase EpsD / Capsular polysaccharide synthesis enzyme Cap5B
    • tyrosine-protein kinase YwqD
  • strand?: +
  • coordinates?: 1231298..1231993
  • synteny block?: BlockID0005090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0137 (cap5B)
    N315:
    SA0145 (capB)
    NCTC8325:
    Newman:
    NWMN_0096 (capB)
    USA300_FPR3757:
    SAUSA300_0153 (cap5B)
    04-02981:
    SA2981_0151 (capB)
    08BA02176:
    C248_0139 (capB)
    11819-97:
    MS7_0144
    71193:
    ST398NM01_0164
    ECT-R 2:
    ECTR2_107
    ED133:
    SAOV_0097
    ED98:
    SAAV_0118 (cap5B)
    HO 5096 0412:
    SAEMRSA15_01160 (capB)
    JH1:
    SaurJH1_0141
    JH9:
    SaurJH9_0136
    JKD6008:
    SAA6008_00128 (cap5B)
    JKD6159:
    SAA6159_00134 (cap5B)
    LGA251:
    SARLGA251_01240 (capB)
    M013:
    M013TW_0140
    MRSA252:
    SAR0152 (capB)
    MSHR1132:
    SAMSHR1132_01240
    MSSA476:
    SAS0125
    Mu3:
    SAHV_0149 (capB)
    Mu50:
    SAV0150 (capB)
    MW2:
    MW0125 (cap8B)
    RF122:
    SAB0091 (capB)
    ST398:
    SAPIG0164
    T0131:
    SAT0131_00140
    TCH60:
    HMPREF0772_10348 (cap5B)
    TW20:
    SATW20_01610 (capB)
    USA300_TCH1516:
    USA300HOU_0164 (cap5B)
    VC40:
    SAVC_00520

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKST
    N315            ---MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKST
    NCTC8325        ---MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKST
    Newman          MLLMSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKST
    USA300_FPR3757  ---MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKST
                       *********************************************************

    COL             VVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIE
    N315            VVSNVAITYAQAGYKTLVIDGDMCKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIE
    NCTC8325        VVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIE
    Newman          VVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIE
    USA300_FPR3757  VVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIE
                    *********************** ************************************

    COL             NLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDS
    N315            NLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDS
    NCTC8325        NLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDS
    Newman          NLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDS
    USA300_FPR3757  NLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDS
                    ************************************************************

    COL             LLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
    N315            LLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
    NCTC8325        LLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
    Newman          LLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
    USA300_FPR3757  LLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
                    ***************************************************