From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000986000
  • symbol?: capI
  • description?: capsular polysaccharide synthesis protein Cap5I

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein Cap5I
    • capsular polysaccharide synthesis enzyme Cap5I
    • capsular polysaccharide biosynthesis protein Cap5I
    • capsular polysaccharide biosynthesis protein CapI
    • glycosyltransferase
    • capsular polysaccharide biosynthesis protein CapI5
  • strand?: +
  • coordinates?: 1244542..1245651
  • synteny block?: BlockID0005200
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0144 (cap5I)
    N315:
    SA0152 (capI)
    NCTC8325:
    Newman:
    NWMN_0103 (capI)
    USA300_FPR3757:
    SAUSA300_0160 (cap5I)
    04-02981:
    SA2981_0158 (capI)
    08BA02176:
    C248_0146 (capI)
    11819-97:
    71193:
    ST398NM01_0171
    ECT-R 2:
    ECTR2_114
    ED133:
    ED98:
    SAAV_0125 (cap5I)
    HO 5096 0412:
    SAEMRSA15_01230 (capI5)
    JH1:
    SaurJH1_0148
    JH9:
    SaurJH9_0143
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0156 (capI)
    Mu50:
    SAV0157 (capI)
    MW2:
    RF122:
    ST398:
    SAPIG0171
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0171 (cap5I)
    VC40:
    SAVC_00555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRILNIVSSNIVQDPRVLKQIETIKGVTDDYKIVGMNNSQATNKRLENLDCNYRLLGSKV
    N315            MRILNIVSSNIVQDPRVLKQIETIKGVTNDYKIVGMNNSQATNRRLENLDCNYRLLGSKV
    NCTC8325        MRILNIVSSNIVQDPRVLKQIETIKGVTDDYKIVGMNNSQATNKRLENLDCNYRLLGSKV
    Newman          MRILNIVSSNIVQDPRVLKQIETIKGVTDDYKIVGMNNSQATNKRLENLDCNYRLLGSKV
    USA300_FPR3757  MRILNIVSSNIVQDPRVLKQIETIKGVTDDYKIVGMNNSQATNKRLENLDCNYRLLGSKV
                    ****************************:**************:****************

    COL             DPKNILSKLIKRIRFATGVIREIKAYKPDVIHANDFDVLLMVYLSNYKKANIVYDAHEIY
    N315            DPKNILSKLIKRIRFATGVIREIKAFKPDVIHANDFDVLLMVYLSNYKKANIVYDAHEIY
    NCTC8325        DPKNILSKLIKRIRFATGVIREIKAYKPDVIHANDFDVLLMVYLSNYKKANIVYDAHEIY
    Newman          DPKNILSKLIKRIRFATGVIREIKAYKPDVIHANDFDVLLMVYLSNYKKANIVYDAHEIY
    USA300_FPR3757  DPKNILSKLIKRIRFATGVIREIKAYKPDVIHANDFDVLLMVYLSNYKKANIVYDAHEIY
                    *************************:**********************************

    COL             AKNAFINKVPLISKFVESIEKHIVKHRVNAFVTVSHAAKEYYQSKGYKKEANVITNAPIL
    N315            AKNAFINKVPLISKFVESIEKHIVKHRVNAFVTVSHAAKEYYQSKGYKKEANVITNAPIL
    NCTC8325        AKNAFINKVPLISKFVESIEKHIVKHRVNAFVTVSHAAKEYYQSKGYKKEANVITNAPIL
    Newman          AKNAFINKVPLISKFVESIEKHIVKHRVNAFVTVSHAAKEYYQSKGYKKEANVITNAPIL
    USA300_FPR3757  AKNAFINKVPLISKFVESIEKHIVKHRVNAFVTVSHAAKEYYQSKGYKKEANVITNAPIL
                    ************************************************************

    COL             NDSREFKEIENFKEIVYQGQIVMDRGYEEFIIASSAFKQNAPSFIIRGFGPHEEVIKELI
    N315            NDSREFKEIENFKEIVYQGQIVMDRGYEEFIIASSAFKQNAPSFIIRGFGPHEEVIKELI
    NCTC8325        NDSREFKEIENFKEIVYQGQIVMDRGYEEFIIASSAFKQNAPSFIIRGFGPHEEVIKELI
    Newman          NDSREFKEIENFKEIVYQGQIVMDRGYEEFIIASSAFKQNAPSFIIRGFGPHEEVIKELI
    USA300_FPR3757  NDSREFKEIENFKEIVYQGQIVMDRGYEEFIIASSAFKQNAPSFIIRGFGPHEELIKELI
                    ******************************************************:*****

    COL             SYNPENIRLDKPVEVKELVDKLAESNVGVVLTKPVSINFEYTVSNKIFECIHAGLPVILS
    N315            SYNSENIRLDKPVEVKELVDKLAESNVGVILTKPVSINFEYTVSNKIFECIHAGLPVILS
    NCTC8325        SYNPENIRLDKPVEVKELVDKLAESNVGVVLTKPVSINFEYTVSNKIFECIHAGLPVILS
    Newman          SYNPENIRLDKPVEVKELVDKLAESNVGVVLTKPVSINFEYTVSNKIFECIHAGLPVILS
    USA300_FPR3757  SYNPENIRLDKPVEVKELVDKLAESNVGVVLTKPVSINFEYTVSNKIFECIHAGLPVILS
                    ***.*************************:******************************

    COL             PVKEHIYLNEKYKFGIVLKEVTPLEIEKAVRKLRDNHDLFNHLRQNAIKASKILNWQIES
    N315            PVKEHIYLNEKYKFGIVLKEVTPLEIEKAVRKLRDNHDLFNHLRQNAIKASKILNWQIES
    NCTC8325        PVKEHIYLNEKYKFGIVLKEVTPLEIEKAVRKLRDNHDLFNHLRQNAIKASKILNWQIES
    Newman          PVKEHIYLNEKYKFGIVLKEVTPLEIEKAVRKLRDNHDLFNHLRQNAIKASKILNWQIES
    USA300_FPR3757  PVKEHIYLNEKYKFGIVLKEVTPLEIEKAVRKLRDNHDLFNHLRQNAIKASKILNWQIES
                    ************************************************************

    COL             ERLVELYKF
    N315            ERLVELYKF
    NCTC8325        ERLVELYKF
    Newman          ERLVELYKF
    USA300_FPR3757  ERLVELYKF
                    *********