From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000987000
  • symbol?: capJ
  • description?: capsular polysaccharide biosynthesis protein

      descriptions from strain specific annotations:

    • capsular polysaccharide biosynthesis protein
    • capsular polysaccharide biosynthesis protein Cap5J
    • capsular polysaccharide synthesis protein Cap5J
    • capsular polysaccharide biosynthesis protein CapJ
    • capsular polysaccharide synthesis enzyme Cap5J
    • O-antigen polymerase
    • O-Antigen Polymerase family protein
  • strand?: +
  • coordinates?: 1245665..1252745
  • synteny block?: BlockID0005200
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0145 (cap5J)
    N315:
    SA0153 (capJ)
    NCTC8325:
    Newman:
    NWMN_0104 (capJ)
    USA300_FPR3757:
    SAUSA300_0161 (cap5J)
    04-02981:
    SA2981_0159 (capJ)
    08BA02176:
    C248_0147 (capJ)
    11819-97:
    71193:
    ST398NM01_0172
    ECT-R 2:
    ECTR2_115
    ED133:
    ED98:
    SAAV_0126 (cap5J)
    HO 5096 0412:
    SAEMRSA15_01240 (cap5J)
    JH1:
    SaurJH1_0149
    JH9:
    SaurJH9_0144
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0157 (capJ)
    Mu50:
    SAV0158 (capJ)
    MW2:
    RF122:
    ST398:
    SAPIG0172
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0172 (cap5J)
    VC40:
    SAVC_00560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFFVLCAIISMNIFIVISTFTKEVLGFPIEPVYYSTMVGIALITTVFAIYKIIVTQEIP
    N315            MKFFVLCAIISMNIFIVISTFTKEVLGFPIEPVYYSTMVGIALITTVFAIYKIIVTQEIP
    NCTC8325        MKFFVLCAIISMNIFIVISTFTKEVLGFPIEPVYYSTMVGIALITTVFAIYKIIVTQEIP
    Newman          MKFFVLCAIISMNIFIVISTFTKEVLGFPIEPVYYSTMVGIALITTVFAIYKIIVTQEIP
    USA300_FPR3757  MKFFVLCAIISMNIFIVISTFTKEVLGFPIEPVYYSTMVGIALITTVFAIYKIIVTQEIP
                    ************************************************************

    COL             RGLILLIAICLLYLAFYYFSPDKEEKLAKNNILFFLTWAVPAAISGIYIKYINKATVERF
    N315            RGLILLIAICLLYLAFYYFSPDKEEKLAKNNILFFLTWAVPAAISGIYIKYINKATVERF
    NCTC8325        RGLILLIAICLLYLAFYYFSPDKEEKLAKNNILFFLTWAVPAAISGIYIKYINKATVERF
    Newman          RGLILLIAICLLYLAFYYFSPDKEEKLAKNNILFFLTWAVPAAISGIYIKYINKATVERF
    USA300_FPR3757  RGLILLIAICLLYLAFYYFSPDKEEKLAKNNILFFLTWAVPAAISGIYIKYINKATVERF
                    ************************************************************

    COL             FKLVFFIFSVSFIFVILIPKLTGEIPSYINFGLMNYQNASYLSAFTAGLGIYFIMKGSVK
    N315            FKLVFFIFSISFIFVILIPKLTGEIPSYINFGLMNYQNASYLSAFTAGLGIYFIMKGSVK
    NCTC8325        FKLVFFIFSVSFIFVILIPKLTGEIPSYINFGLMNYQNASYLSAFTAGLGIYFIMKGSVK
    Newman          FKLVFFIFSVSFIFVILIPKLTGEIPSYINFGLMNYQNASYLSAFTAGLGIYFIMKGSVK
    USA300_FPR3757  FKLVFFIFSVSFIFVILIPKLTGEIPSYINFGLMNYQNASYLSAFTAGLGIYFIMKGSVK
                    *********:**************************************************

    COL             HKWIYVLFTIIDIPIVFIPGGRGGAILLILYGLFAFILITFKRGIPIAVKSIMYIFALSI
    N315            HKWIYVLFTIIDIPIVFIPGGRGGAILLILYGLFAFILITFKRGIPIAVKSIMYIFALSI
    NCTC8325        HKWIYVLFTIIDIPIVFIPGGRGGAILLILYGLFAFILITFKRGIPIAVKSIMYIFALSI
    Newman          HKWIYVLFTIIDIPIVFIPGGRGGAILLILYGLFAFILITFKRGIPIAVKSIMYIFALSI
    USA300_FPR3757  HKWIYVLFTIIDIPIVFIPGGRGGAILLILYGLFAFILITFKRGIPIAVKSIMYIFALSI
                    ************************************************************

    COL             SSVLIYFLFTKGSNTRTFSYLQGGTLNLEGTSGRGPIYEKGIYFIQQSSLLGYGPFNYYK
    N315            SSVLIYFLFTKGSNTRTFSYLQGGTLNLEGTSGRGPIYEKGIYFIQQSPLLGYGPFNYYK
    NCTC8325        SSVLIYFLFTKGSNTRTFSYLQGGTLNLEGTSGRGPIYEKGIYFIQQSSLLGYGPFNYYK
    Newman          SSVLIYFLFTKGSNTRTFSYLQGGTLNLEGTSGRGPIYEKGIYFIQQSSLLGYGPFNYYK
    USA300_FPR3757  SSVLIYFLFTKGSNTRTFSYLQGGTLNLEGTSGRGPIYEKGIYFIQQSSLLGYGPFNYYK
                    ************************************************.***********

    COL             LIGNIPHNIIIELILSFGLLGFFIIMICILLLVYKMIRNYDPNTIDLLVMFIAIYPITLL
    N315            LIGNIPHNIIIELILSFGLLGFFIIMICILLLVYKMIRNYDPNTIDLLVMFIAIYPITLL
    NCTC8325        LIGNIPHNIIIELILSFGLLGFFIIMICILLLVYKMIRNYDPNTIDLLVMFIAIYPITLL
    Newman          LIGNIPHNIIIELILSFGLLGFFIIMICILLLVYKMIRNYDPNTIDLLVMFIAIYPITLL
    USA300_FPR3757  LIGNIPHNIIIELILSFGLLGFFIIMICILLLVYKMIRNYDPNTIDLLVMFIAIYPITLL
                    ************************************************************

    COL             MFSSNYLVVSEFWFVLFYFITKGRRHHG
    N315            MFSSNYLVVSEFWFVLFYFITKGRRHHG
    NCTC8325        MFSSNYLVVSEFWFVLFYFITKGRRHHG
    Newman          MFSSNYLVVSEFWFVLFYFITKGRRHHG
    USA300_FPR3757  MFSSNYLVVSEFWFVLFYFITKGRRHHG
                    ****************************