From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000990000
  • symbol?: capL
  • description?: capsular polysaccharide synthesis protein Cap5L

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein Cap5L
    • capsular polysaccharide synthesis enzyme Cap5L
    • group 1 glycosyl transferase
    • capsular polysaccharide biosynthesis protein Cap5L
    • cap8L
    • cap5L protein/glycosyltransferase
    • capsular polysaccharide biosynthesis protein glycosyltransferase CapL
    • capsular polysaccharide synthesis enzyme Cap8L
    • glycosyl transferases group 1 family protein
    • capsular polysaccharide synthesis enzyme CapL
    • capsular polysaccharide biosynthesis protein CapL
  • strand?: +
  • coordinates?: 1258821..1260400
  • synteny block?: BlockID0005230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0147 (cap5L)
    N315:
    SA0155 (capL)
    NCTC8325:
    Newman:
    NWMN_0106 (capL)
    USA300_FPR3757:
    SAUSA300_0163 (cap5L)
    04-02981:
    SA2981_0161 (capL)
    08BA02176:
    C248_0149 (capL)
    11819-97:
    MS7_0154
    71193:
    ST398NM01_0174
    ECT-R 2:
    ECTR2_117
    ED133:
    SAOV_0107
    ED98:
    SAAV_0128 (cap5L)
    HO 5096 0412:
    SAEMRSA15_01260 (capL)
    JH1:
    SaurJH1_0151
    JH9:
    SaurJH9_0146
    JKD6008:
    SAA6008_00138 (cap5L)
    JKD6159:
    SAA6159_00144 (cap5L)
    LGA251:
    SARLGA251_01340 (capL)
    M013:
    M013TW_0150
    MRSA252:
    SAR0162 (capL)
    MSHR1132:
    SAMSHR1132_01340
    MSSA476:
    SAS0135
    Mu3:
    SAHV_0159 (capL)
    Mu50:
    SAV0160 (capL)
    MW2:
    MW0135 (cap8L)
    RF122:
    SAB0101 (capL)
    ST398:
    SAPIG0174
    T0131:
    SAT0131_00151
    TCH60:
    HMPREF0772_10338 (cap5L)
    TW20:
    SATW20_01710 (capL)
    USA300_TCH1516:
    USA300HOU_0174 (cap5L)
    VC40:
    SAVC_00570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWPYEYSNHKQVSKTEMH
    N315            MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWPYEYSNHKQVSKTEMH
    NCTC8325        MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWPYEYSNHKQVSKTEMH
    Newman          MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWPYEYSNHKQVSKTEMH
    USA300_FPR3757  MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWPYEYSNHKQVSKTEMH
                    ************************************************************

    COL             RGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQILVYSNPPILPLIPDV
    N315            RGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQILVYSNPPILPLIPDV
    NCTC8325        RGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQILVYSNPPILPLIPDV
    Newman          RGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQILVYSNPPILPLIPDV
    USA300_FPR3757  RGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQILVYSNPPILPLIPDV
                    ************************************************************

    COL             LHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRHVYKNAENVIVLGTEMKN
    N315            LHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRHVYKNAENVIVLGTEMKN
    NCTC8325        LHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRHVYKNAENVIVLGTEMKN
    Newman          LHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRHVYKNAENVIVLGTEMKN
    USA300_FPR3757  LHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRHVYKNAENVIVLGTEMKN
                    ************************************************************

    COL             YLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQYDKILLYSGNMGQLQDME
    N315            YLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQYDKILLYSGNMGQLQDME
    NCTC8325        YLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQYDKILLYSGNMGQLQDME
    Newman          YLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQYDKILLYSGNMGQLQDME
    USA300_FPR3757  YLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQYDKILLYSGNMGQLQDME
                    ************************************************************

    COL             TLISFLKLNKDQSQTLTILCGHGKKFADVKTAIEDHRIENVKMFEFLTGTDYADVLKIAD
    N315            TLISFLKLNKDQPQTLTILCGHGKKFADVKTAIEDHRIENVKMFEFLTGTDYADVLKIAD
    NCTC8325        TLISFLKLNKDQSQTLTILCGHGKKFADVKTAIEDHRIENVKMFEFLTGTDYADVLKIAD
    Newman          TLISFLKLNKDQSQTLTILCGHGKKFADVKTAIEDHRIENVKMFEFLTGTDYADVLKIAD
    USA300_FPR3757  TLISFLKLNKDQSQTLTILCGHGKKFADVKTAIEDHRIENVKMFEFLTGTDYADVLKIAD
                    ************.***********************************************

    COL             VCIASLIKEGVGLGVPSKNYGYLAAKKALVLIMDKQSDIVQHVEQYDAGIQIDNGDAHAI
    N315            VCIASLIKEGVGLGVPSKNYGYLAAKKPLVLIMDKQSDIVQHVEQYDAGIQIDNGDAHAI
    NCTC8325        VCIASLIKEGVGLGVPSKNYGYLAAKKALVLIMDKQSDIVQHVEQYDAGIQIDNGDAHAI
    Newman          VCIASLIKEGVGLGVPSKNYGYLAAKKALVLIMDKQSDIVQHVEQYDAGIQIDNGDAHAI
    USA300_FPR3757  VCIASLIKEGVGLGVPSKNYGYLAAKKALVLIMDKQSDIVQHVEQYDAGIQIDNGDAHAI
                    ***************************.********************************

    COL             YNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNLLK
    N315            YNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNLLK
    NCTC8325        YNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNLLK
    Newman          YNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNLLK
    USA300_FPR3757  YNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNLLK
                    *****************************************