From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001001000
  • symbol?: isdI
  • description?: heme-degrading monooxygenase IsdI

      descriptions from strain specific annotations:

    • heme-degrading monooxygenase IsdI
    • Heme-degrading cytoplasmic oxygenase IsdI
    • antibiotic biosynthesis monooxygenase family protein
    • heme-degrading monooxygenase IsdG (Iron-regulatedsurface determinant isdG) (Iron-responsive surface determinant isdG)(Heme oxygenase)
    • heme-degrading enzyme IsdG
    • pseudogene
  • strand?: -
  • coordinates?: 1270315..1270635
  • synteny block?: BlockID0005290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0166 (isdI)
    08BA02176:
    C248_0154
    11819-97:
    MS7_0159 (isdI)
    71193:
    ST398NM01_0179
    ECT-R 2:
    ECTR2_129
    ED133:
    SAOV_0112
    ED98:
    SAAV_0133
    HO 5096 0412:
    SAEMRSA15_01310
    JH1:
    SaurJH1_0156
    JH9:
    SaurJH9_0151
    JKD6008:
    SAA6008_00143 (isdI)
    JKD6159:
    SAA6159_00149 (isdI)
    LGA251:
    SARLGA251_01390 (isdI)
    M013:
    M013TW_0155
    MRSA252:
    SAR0167
    MSHR1132:
    SAMSHR1132_01390
    MSSA476:
    SAS0140
    Mu3:
    SAHV_0164
    Mu50:
    SAV0165 (isdI)
    MW2:
    MW0140
    RF122:
    SAB0106c
    ST398:
    SAPIG0179
    T0131:
    SAT0131_00156
    TCH60:
    HMPREF0772_10333 (isdI)
    TW20:
    SATW20_01760 (isdI)
    USA300_TCH1516:
    USA300HOU_0179 (isdG1)
    VC40:
    SAVC_00595

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESE
    N315            MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESE
    NCTC8325        MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESE
    Newman          MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESE
    USA300_FPR3757  MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESE
                    ************************************************************

    COL             DSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
    N315            DSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
    NCTC8325        DSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
    Newman          DSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
    USA300_FPR3757  DSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
                    ************************************************